Signal Peptide Database - Mammalia

 Entry Details
ID   58
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q32KH7    (Created: 2008-12-16 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   ARSI_CANFA
Protein Name   Arylsulfatase I
Gene   ARSI
Organism Scientific   Canis familiaris
Organism Common   Dog
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Laurasiatheria
                  Carnivora
                    Caniformia
                      Canidae
                        Canis
Protein Length [aa]   573
Protein Mass [Da]   64347
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   23
chain   Arylsulfatase I      24   573
modified residue   3-oxoalanine (Cys)   by similarity   94   94
glycosylation site   N-linked (GlcNAc...)   potential   277   277
glycosylation site   N-linked (GlcNAc...)   potential   289   289
glycosylation site   N-linked (GlcNAc...)   potential   467   467
glycosylation site   N-linked (GlcNAc...)   potential   497   497
active site      by similarity   150   150
metal ion-binding site   Calcium   by similarity   56   56
metal ion-binding site   Calcium   by similarity   57   57
metal ion-binding site   Calcium; via 3-oxoalanine   by similarity   94   94
metal ion-binding site   Calcium   by similarity   298   298
metal ion-binding site   Calcium   by similarity   299   299
compositionally biased region   Poly-Glu      528   536
SP Length   23
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MHALTGLSLVSLLSFGYLSWDWA
Sequence MHALTGLSLVSLLSFGYLSWDWAKPSLVADGPGEPGLEQPSAPPPQPPHI
IFILT
DDQGYHDVGYHGSDIETPTLDRLAAEGVKLENYYIQPICTPSRSQ
LLTGRYQIHTGLQHSIIRPRQPNCLPLDQVTLPQKLQEAGYSTHMVGKW
H
LGFYRKECLPTRRGFDTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGENV
AWGLSGQYSTMLYAQRVSHILASHSPRRPLFLYVAFQAVHTPLQSPREYL
YRYRTMGNVARRKYAAMVTCMDEAVR
NITSALKRYGFYNNSVIIFSSDNG
GQTFSGGSNWPLRGRKGTYWEGGVRGLGFVHSPLLKRKRRTSRALVHITD
WYPTLVGLAGGTASAADGLDGYDVWPAISEGRASPRTEILHNIDPLYNHA
RHGSLEAGFGIWNTAVQAAIRVGEWKLLTGDPGYGDWIPPQTLAAFPGSW
WNLERMASARQAVWLF
NISADPYEREDLAGQRPDVVRALLARLVDYNRTA
IPVRYPAENPRAHPDFNGGAWGPWASD
EEEEEEEEEAGRARSFSRGRRKK
KCKICKLRSFFRKLNTRLMSQRI
Original MHALTGLSLVSLLSFGYLSWDWAKPSLVADGPGEPGLEQPSAPPPQPPHI
IFILTDDQGYHDVGYHGSDIETPTLDRLAAEGVKLENYYIQPICTPSRSQ
LLTGRYQIHTGLQHSIIRPRQPNCLPLDQVTLPQKLQEAGYSTHMVGKWH
LGFYRKECLPTRRGFDTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGENV
AWGLSGQYSTMLYAQRVSHILASHSPRRPLFLYVAFQAVHTPLQSPREYL
YRYRTMGNVARRKYAAMVTCMDEAVRNITSALKRYGFYNNSVIIFSSDNG
GQTFSGGSNWPLRGRKGTYWEGGVRGLGFVHSPLLKRKRRTSRALVHITD
WYPTLVGLAGGTASAADGLDGYDVWPAISEGRASPRTEILHNIDPLYNHA
RHGSLEAGFGIWNTAVQAAIRVGEWKLLTGDPGYGDWIPPQTLAAFPGSW
WNLERMASARQAVWLFNISADPYEREDLAGQRPDVVRALLARLVDYNRTA
IPVRYPAENPRAHPDFNGGAWGPWASDEEEEEEEEEAGRARSFSRGRRKK
KCKICKLRSFFRKLNTRLMSQRI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11