Signal Peptide Database - Mammalia

 Entry Details
ID   59
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   A8CEN3    (Created: 2008-03-18 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ASIP_MACAS
Protein Name   Agouti-signaling protein
Gene   ASIP
Organism Scientific   Macaca assamensis
Organism Common   Assam's macaque
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Cercopithecidae
                          Cercopithecinae
                            Macaca
Protein Length [aa]   132
Protein Mass [Da]   14645
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   22
chain   Agouti-signaling protein      23   132
disulfide bond      by similarity   93   108
disulfide bond      by similarity   100   114
disulfide bond      by similarity   107   125
disulfide bond      by similarity   111   132
disulfide bond      by similarity   116   123
domain   Agouti      93   132
glycosylation site   N-linked (GlcNAc...)   potential   39   39
compositionally biased region   Arg/Lys-rich (basic)      57   86
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MDVTRLLLATLLVFLCFFTAYS
Sequence MDVTRLLLATLLVFLCFFTAYSHPPPEEKLRDDRSLRSNSSVNLLDFPSV
SIVALN
KKSKQTSRKEAEKKRSSKKEASMKKVARPRTPLSAPCVATRDSC
KPPAPACCDPCASCQCRFFRSACSCRVLSLNC
Original MDVTRLLLATLLVFLCFFTAYSHPPPEEKLRDDRSLRSNSSVNLLDFPSV
SIVALNKKSKQTSRKEAEKKRSSKKEASMKKVARPRTPLSAPCVATRDSC
KPPAPACCDPCASCQCRFFRSACSCRVLSLNC
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11