Signal Peptide Database - Mammalia

 Entry Details
ID   60
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q64191    (Created: 1997-11-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   ASPG_MOUSE
Protein Name   N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase
Gene   Aga
Organism Scientific   Mus musculus
Organism Common   Mouse
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Mus
Protein Length [aa]   346
Protein Mass [Da]   37022
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   23
chain   Glycosylasparaginase alpha chain      24   205
chain   Glycosylasparaginase beta chain      206   346
disulfide bond      by similarity   64   69
disulfide bond      by similarity   163   179
disulfide bond      by similarity   286   306
disulfide bond      by similarity   317   345
glycosylation site   N-linked (GlcNAc...)   potential   38   38
glycosylation site   N-linked (GlcNAc...)   potential   310   310
active site   Nucleophile   by similarity   206   206
SP Length   23
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MERKSNLSLLLLLLVLGMPLVRG
Sequence MERKSNLSLLLLLLVLGMPLVRGSSPLPLVVNTWPFKNATEAAWWTLLSG
GSALDAVENGCAV
CEKEQCDGTVGFGGSPDEGGETTLDAMIMDGTAMDVG
AVGGLRRIKNAIGVARRVLEHTTHTLLVGDSATKFAESMGFTNEDLSTKT
SRDLHSDWLSRN
CQPNYWRNVIPDPSKYCGPYKPSGFLKQSISPHKEEVD
IHSHD
TIGMVVIHKTGHTAAGTSTNGIKFKIPGRVGDSPIPGAGAYADDT
AGAAAATGDGDTLLRFLPSYQAVEYMRGGDDPAIA
CQKVILRIQKYYPNF
FGAVIC
ASVNGSYGAACNKLPTFTQFSFMVSNSLHNEPTEKKVDCI
Original MERKSNLSLLLLLLVLGMPLVRGSSPLPLVVNTWPFKNATEAAWWTLLSG
GSALDAVENGCAVCEKEQCDGTVGFGGSPDEGGETTLDAMIMDGTAMDVG
AVGGLRRIKNAIGVARRVLEHTTHTLLVGDSATKFAESMGFTNEDLSTKT
SRDLHSDWLSRNCQPNYWRNVIPDPSKYCGPYKPSGFLKQSISPHKEEVD
IHSHDTIGMVVIHKTGHTAAGTSTNGIKFKIPGRVGDSPIPGAGAYADDT
AGAAAATGDGDTLLRFLPSYQAVEYMRGGDDPAIACQKVILRIQKYYPNF
FGAVICASVNGSYGAACNKLPTFTQFSFMVSNSLHNEPTEKKVDCI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11