Signal Peptide Database - Mammalia

 Entry Details
ID   63
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q61137    (Created: 2000-12-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   ASTN1_MOUSE
Protein Name   Astrotactin-1
Gene   Astn1
Organism Scientific   Mus musculus
Organism Common   Mouse
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Mus
Protein Length [aa]   1302
Protein Mass [Da]   144928
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
chain   Astrotactin-1      22   1302
disulfide bond      by similarity   463   475
disulfide bond      by similarity   471   490
disulfide bond      by similarity   492   506
disulfide bond      by similarity   612   625
disulfide bond      by similarity   619   636
disulfide bond      by similarity   638   651
disulfide bond      by similarity   660   672
disulfide bond      by similarity   668   692
disulfide bond      by similarity   694   707
transmembrane region      potential   154   174
transmembrane region      potential   389   409
domain   EGF-like 1      459   507
domain   EGF-like 2      608   652
domain   EGF-like 3      656   708
domain   Fibronectin type-III 1      796   877
domain   Fibronectin type-III 2      1030   1145
modified residue   Phosphoserine      54   54
modified residue   Phosphoserine      1088   1088
modified residue   Phosphoserine   by similarity   1277   1277
glycosylation site   N-linked (GlcNAc...)   potential   115   115
glycosylation site   N-linked (GlcNAc...)   potential   226   226
glycosylation site   N-linked (GlcNAc...)   potential   382   382
glycosylation site   N-linked (GlcNAc...)   potential   453   453
glycosylation site   N-linked (GlcNAc...)   potential   729   729
glycosylation site   N-linked (GlcNAc...)   potential   742   742
glycosylation site   N-linked (GlcNAc...)   potential   804   804
glycosylation site   N-linked (GlcNAc...)   potential   984   984
splice variant   (in isoform 2)      480   487
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MALAGLCALFACCWGPAAVLA
Sequence MALAGLCALFACCWGPAAVLATAAGDVDPSKELECKLKSITVSALPFLRE
NDL
SIMHSPSASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNT
EDIPLVRWRQQWLE
NGTLLFHIHHQDGAPSLPGQDPTEEPQHESAEEELR
ILH
ISVMGGMIALLLSILCLVMILYTRRRWCKRRRVPQPQKSASAEAANE
IHYIPSVLIGGHGRESLRNARVQGH
NSSGTLSIRETPILDGYEYDITDLR
HHLQRECMNGGEDFASQVTRTLDSLQGCNEKSGMDLTPGSDNAKLSLMNK
YKDNIIATSPVDSNHQQATLLSHTSSSQRKRINNKARAGSAFLNPEGDSS
TEAENDPQLTFYTDPSRSRRRSRVGSPRSPV
NKTTLTLISVTSCVIGLVC
SSHVSCPLV
VKITLHVPEHLIADGSRFILLEGSQLDASDWLNPAQVVLFS
QQ
NSSGPWAMDLCARRLLDPCEHQCDPETGRREHRADGECLCYEGYMKDP
VHKHLCI
RNEWGTNQGPWPYTIFQRGFDLVLGEQPSDKIFRFTYTLGEGM
WLPLSKSFVIPPAELAINPSAKCKTDMTVMEDAVEVREELMTSSSFDSLE
VLLDSFG
PVRDCSKDNGGCSKNFRCISDRKLDSTGCVCPSGLSPMKDSSG
CY
DRHIGVDCSDGFNGGCEQLCLQQMAPFPEDPTLYNILMFCGCIEDYKL
GVDGRSCQ
LVTETCPEGGDCGESREVPMNQTLFGEMFFGYNNQSKEVATG
QVLKGTFRQNNFARGLDQQLPDGLVVASVPLENQCLEEISEPTPD
PDFLT
GMV
NFSEVSGYPVLQHWKVRSVMYHIKLNQAAISQAFSNALHSLDGATSR
ADFVALLDQFGNHYIQEAVYGFEESCS
IWYPNKQVQRRLWLEYEDISKGN
SPSDESEERERDPKVLTFPEYIASLSDSGTKRMAAGVRMECQSKGRCPSS
CPLCHVTSSPETPAEPVLLEVTRASPIYELVTN
NQTQRLLQEATMSSLWC
SGTGDVIEDWCRCDSTAFGADGLPTCAPL
PQPVLRLSTVHEPSSNLVVLE
WEHSEPPIGVQIVDYLIRQEKVTDRMDHSKVETETVL
SFVDDIISGAKAP
CAMPSQVPDKQLTTISLIIRCLEPDTIYMFTLWGVDNTGRRSRPS
DVIVK
TPCPVVDDVKAQEIADKIYNLFNGYTSGKEQQTAYNTLLDLGSPTLHRVL
YHYNQHYESFGEFTWRCEDELGPRKAGLILSQLGDLSSWCNGLLQEPKIS
LRRGSLKYLGCRYSEIKPYGLDWSEL
SRDLRKTCEEQTLSVPYNDYGDSK
DI
Original MALAGLCALFACCWGPAAVLATAAGDVDPSKELECKLKSITVSALPFLRE
NDLSIMHSPSASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNT
EDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEPQHESAEEELR
ILHISVMGGMIALLLSILCLVMILYTRRRWCKRRRVPQPQKSASAEAANE
IHYIPSVLIGGHGRESLRNARVQGHNSSGTLSIRETPILDGYEYDITDLR
HHLQRECMNGGEDFASQVTRTLDSLQGCNEKSGMDLTPGSDNAKLSLMNK
YKDNIIATSPVDSNHQQATLLSHTSSSQRKRINNKARAGSAFLNPEGDSS
TEAENDPQLTFYTDPSRSRRRSRVGSPRSPVNKTTLTLISVTSCVIGLVC
SSHVSCPLVVKITLHVPEHLIADGSRFILLEGSQLDASDWLNPAQVVLFS
QQNSSGPWAMDLCARRLLDPCEHQCDPETGRREHRADGECLCYEGYMKDP
VHKHLCIRNEWGTNQGPWPYTIFQRGFDLVLGEQPSDKIFRFTYTLGEGM
WLPLSKSFVIPPAELAINPSAKCKTDMTVMEDAVEVREELMTSSSFDSLE
VLLDSFGPVRDCSKDNGGCSKNFRCISDRKLDSTGCVCPSGLSPMKDSSG
CYDRHIGVDCSDGFNGGCEQLCLQQMAPFPEDPTLYNILMFCGCIEDYKL
GVDGRSCQLVTETCPEGGDCGESREVPMNQTLFGEMFFGYNNQSKEVATG
QVLKGTFRQNNFARGLDQQLPDGLVVASVPLENQCLEEISEPTPDPDFLT
GMVNFSEVSGYPVLQHWKVRSVMYHIKLNQAAISQAFSNALHSLDGATSR
ADFVALLDQFGNHYIQEAVYGFEESCSIWYPNKQVQRRLWLEYEDISKGN
SPSDESEERERDPKVLTFPEYIASLSDSGTKRMAAGVRMECQSKGRCPSS
CPLCHVTSSPETPAEPVLLEVTRASPIYELVTNNQTQRLLQEATMSSLWC
SGTGDVIEDWCRCDSTAFGADGLPTCAPLPQPVLRLSTVHEPSSNLVVLE
WEHSEPPIGVQIVDYLIRQEKVTDRMDHSKVETETVLSFVDDIISGAKAP
CAMPSQVPDKQLTTISLIIRCLEPDTIYMFTLWGVDNTGRRSRPSDVIVK
TPCPVVDDVKAQEIADKIYNLFNGYTSGKEQQTAYNTLLDLGSPTLHRVL
YHYNQHYESFGEFTWRCEDELGPRKAGLILSQLGDLSSWCNGLLQEPKIS
LRRGSLKYLGCRYSEIKPYGLDWSELSRDLRKTCEEQTLSVPYNDYGDSK
DI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11