Signal Peptide Database - Mammalia

 Entry Details
ID   65
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9WUQ1    (Created: 2000-12-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   ATS1_RAT
Protein Name   A disintegrin and metalloproteinase with thrombospondin motifs 1
Gene   Adamts1
Organism Scientific   Rattus norvegicus
Organism Common   Rat
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Rattus
Protein Length [aa]   967
Protein Mass [Da]   105706
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   54
chain   A disintegrin and metalloproteinase with thrombospondin motifs 1      253   967
disulfide bond      by similarity   379   462
disulfide bond      by similarity   417   446
disulfide bond      by similarity   571   608
disulfide bond      by similarity   575   613
disulfide bond      by similarity   586   598
domain   Peptidase M12B      258   467
domain   Disintegrin      476   558
domain   TSP type-1 1      559   614
domain   TSP type-1 2      854   910
domain   TSP type-1 3      911   967
region of interest   Spacer      725   857
glycosylation site   N-linked (GlcNAc...)   potential   547   547
glycosylation site   N-linked (GlcNAc...)   potential   720   720
glycosylation site   N-linked (GlcNAc...)   potential   764   764
glycosylation site   N-linked (GlcNAc...)   potential   782   782
glycosylation site   N-linked (GlcNAc...)   potential   945   945
active site      by similarity   402   402
propeptide      by similarity   55   252
metal ion-binding site   Zinc; in inhibited form   by similarity   205   205
metal ion-binding site   Zinc; catalytic   by similarity   401   401
metal ion-binding site   Zinc; catalytic   by similarity   405   405
metal ion-binding site   Zinc; catalytic   by similarity   411   411
compositionally biased region   Poly-Arg      194   198
compositionally biased region   Cys-rich      616   724
short sequence motif   Cysteine switch   by similarity   203   210
SP Length   54
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MQPEVPLGSGKLKPCSDMGDIQRAAKFRSSQSAHMLLLLLASITMLLCVR
GAHG
Sequence MQPEVPLGSGKLKPCSDMGDIQRAAKFRSSQSAHMLLLLLASITMLLCVR
GAHG
RPTEEDEELVLPSLERARGHDSTTLLRLDAFGQQLHLKLQPDSGFL
APGFTLQTVGRSPGSEAQHLDPTGDLAHCFYSGTVNGDPSSAAALSLCEG
VRGAFYLQGEEFFIQPAPAVATERLVPAEPKEESIAPPRFHIL
RRRRRGS
GG
AKCGVMDEETLPTSNSGRESQNTPDQWPLRNPTPQGAGKPTGPGSIRK
KR
FVSSPRYVETMLVADQSMADFHGSGLKHYLLTLFSVAARFYKHPSIRN
SISLVVVKILVIYEEQKGPEVTSNAALTLRNFCSWQKQHNSPSDRDPEHY
DTAILFTRQDLCGSHTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTA
HELGHVFNMPHDDAKHCASFNGVSGDSHLMASMLSSLDHSQPWSPCSAYM
VTSFLDNGHGECLMDKP
QNPIKLPSDLPGTLYDANRQCQFTFGEESTHCP
DAASTCSTLWCTGTSGGLLVCQTKHFPWADGTSCGEGKWCVSGKCV
NKTD
MKHFATPV
HGSWGPWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNIEDCP
DNNGKTFREEQCEAHNEFSKASFGNEPTVEWTPKYA
GVSPKDRCKLTCEAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAG
CDRIIDSKKKFDKCGVCGGNGSTC
KKISGTVTSTRPGYHDIVTIPAGATN
IEVKHRNPRGSRN
NGSFLAIRAADGTYILNGNFTLSTLEQDLTYKGTVLR
YSGSSAALERIRSFSPLKEPLTIQVLMVGHALRPKIKYTYFMKKKTEPFN
AIPTFSE
WVIEEWGECSKTCGSGWQRRVVECRDINGHPASECAKEVKPAS
TRPCADLPCP
RWQVGDWSPCSKTCGKGYKKRTLKCLSHDGGVLSNESCDP
LKKPKHYIDFCILTQCS
Original MQPEVPLGSGKLKPCSDMGDIQRAAKFRSSQSAHMLLLLLASITMLLCVR
GAHGRPTEEDEELVLPSLERARGHDSTTLLRLDAFGQQLHLKLQPDSGFL
APGFTLQTVGRSPGSEAQHLDPTGDLAHCFYSGTVNGDPSSAAALSLCEG
VRGAFYLQGEEFFIQPAPAVATERLVPAEPKEESIAPPRFHILRRRRRGS
GGAKCGVMDEETLPTSNSGRESQNTPDQWPLRNPTPQGAGKPTGPGSIRK
KRFVSSPRYVETMLVADQSMADFHGSGLKHYLLTLFSVAARFYKHPSIRN
SISLVVVKILVIYEEQKGPEVTSNAALTLRNFCSWQKQHNSPSDRDPEHY
DTAILFTRQDLCGSHTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTA
HELGHVFNMPHDDAKHCASFNGVSGDSHLMASMLSSLDHSQPWSPCSAYM
VTSFLDNGHGECLMDKPQNPIKLPSDLPGTLYDANRQCQFTFGEESTHCP
DAASTCSTLWCTGTSGGLLVCQTKHFPWADGTSCGEGKWCVSGKCVNKTD
MKHFATPVHGSWGPWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNIEDCPDNNGKTFREEQCEAHNEFSKASFGNEPTVEWTPKYA
GVSPKDRCKLTCEAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAG
CDRIIDSKKKFDKCGVCGGNGSTCKKISGTVTSTRPGYHDIVTIPAGATN
IEVKHRNPRGSRNNGSFLAIRAADGTYILNGNFTLSTLEQDLTYKGTVLR
YSGSSAALERIRSFSPLKEPLTIQVLMVGHALRPKIKYTYFMKKKTEPFN
AIPTFSEWVIEEWGECSKTCGSGWQRRVVECRDINGHPASECAKEVKPAS
TRPCADLPCPRWQVGDWSPCSKTCGKGYKKRTLKCLSHDGGVLSNESCDP
LKKPKHYIDFCILTQCS
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11