Signal Peptide Database - Mammalia

 Entry Details
ID   69
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P27037    (Created: 1992-08-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   AVR2A_HUMAN
Protein Name   Activin receptor type-2A
Gene   ACVR2A
Organism Scientific   Homo sapiens
Organism Common   Human
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Homo
Protein Length [aa]   513
Protein Mass [Da]   57848
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Activin receptor type-2A      20   513
disulfide bond      by similarity   30   60
disulfide bond      by similarity   50   78
disulfide bond      by similarity   85   104
disulfide bond      by similarity   91   103
disulfide bond      by similarity   105   110
transmembrane region      potential   136   161
topological domain   Extracellular   potential   20   135
topological domain   Cytoplasmic   potential   162   513
domain   Protein kinase      192   485
glycosylation site   N-linked (GlcNAc...)   potential   43   43
glycosylation site   N-linked (GlcNAc...)   potential   66   66
sequence variant         0   0
sequence variant   (in a gastric adenocarcinoma sample; somatic mutation)      0   0
active site   Proton acceptor   by similarity   322   322
binding site   ATP   by similarity   219   219
nucleotide phosphate-binding region   ATP   by similarity   198   206
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGAAAKLAFAVFLISCSSG
Sequence MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPC
YGDKDKRRHCFATWK
NISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEV
YFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
YYNILLYSLVPLMLI
AGIVICAFWVY
RHHKMAYPPVLVPTQDPGPPPPSPLLGLKPLQLLEVKAR
GRFGCV
WKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFI
GAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHR
DIKSKNVLLKNNLTACIADFGLALKFEAG
KSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASR
CTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAG
MAMLCETIEECWDHDAEARLSAGCVGERITQMQRL
TNIITTEDIVTVVTM
VTNVDFPPKESSL
Original MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPC
YGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEV
YFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYNILLYSLVPLMLI
AGIVICAFWVYRHHKMAYPPVLVPTQDPGPPPPSPLLGLKPLQLLEVKAR
GRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFI
GAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAG
KSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASR
CTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAG
MAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNIITTEDIVTVVTM
VTNVDFPPKESSL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11