Signal Peptide Database - Mammalia

 Entry Details
ID   7
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P02750    (Created: 1986-07-21 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   A2GL_HUMAN
Protein Name   Leucine-rich alpha-2-glycoprotein
Gene   LRG1
Organism Scientific   Homo sapiens
Organism Common   Human
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Homo
Protein Length [aa]   347
Protein Mass [Da]   38178
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   35
chain   Leucine-rich alpha-2-glycoprotein      36   347
disulfide bond         43   56
disulfide bond         303   329
glycosylation site   O-linked (GalNAc...)      37   37
glycosylation site   N-linked (GlcNAc...)      79   79
glycosylation site   N-linked (GlcNAc...)      186   186
glycosylation site   N-linked (GlcNAc...)      269   269
glycosylation site   N-linked (GlcNAc...)      325   325
sequence variant   (in dbSNP:rs7251081)      0   0
sequence variant   (in dbSNP:rs966384)      0   0
repeat   LRR 1      91   114
repeat   LRR 2      115   138
repeat   LRR 3      140   162
repeat   LRR 4      163   186
repeat   LRR 5      188   210
repeat   LRR 6      212   234
repeat   LRR 7      235   258
repeat   LRR 8      259   282
site   Not glycosylated      306   306
SP Length   35
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWG
Sequence MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDH
GSSISC
QPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLS
SNGLESLSPEFLRP
VPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKEN
QLEVLEVSWLHG
LKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQL
ETLPPDLLRG
PLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLAR
VAAGAFQG
LRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
WI
CDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Original MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDH
GSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLS
SNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKEN
QLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQL
ETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLAR
VAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11