Signal Peptide Database - Mammalia

 Entry Details
ID   70
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   O77530    (Created: 1998-12-15 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   B2MG_CALTO
Protein Name   Beta-2-microglobulin
Gene   B2M
Organism Scientific   Callicebus torquatus
Organism Common   Collared titi
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Platyrrhini
                        Pitheciidae
                          Callicebinae
                            Callicebus
Protein Length [aa]   119
Protein Mass [Da]   13654
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   20
chain   Beta-2-microglobulin      21   119
disulfide bond      by similarity   45   100
domain   Ig-like C1-type      25   114
SP Length   20
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAPFVAIALLVLLSLSGLEA
Sequence MAPFVAIALLVLLSLSGLEAIQHAPKIQVYSRHPAENGKPNFLNCYVSGF
HPSDIEVDLLKNGKKIEKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYAC
RVSHVTFSTPKTVK
WDRNM
Original MAPFVAIALLVLLSLSGLEAIQHAPKIQVYSRHPAENGKPNFLNCYVSGF
HPSDIEVDLLKNGKKIEKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYAC
RVSHVTFSTPKTVKWDRNM
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11