Signal Peptide Database - Mammalia

 Entry Details
ID   71
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9D0L6    (Created: 2004-07-19 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   BAMBI_MOUSE
Protein Name   BMP and activin membrane-bound inhibitor homolog
Gene   Bambi
Organism Scientific   Mus musculus
Organism Common   Mouse
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Mus
Protein Length [aa]   260
Protein Mass [Da]   29198
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   26
chain   BMP and activin membrane-bound inhibitor homolog      27   260
transmembrane region      potential   153   173
topological domain   Extracellular   potential   27   152
topological domain   Cytoplasmic   potential   174   260
glycosylation site   N-linked (GlcNAc...)   potential   87   87
SP Length   26
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MDRHSSYFFIWLQLELCAMAVLLTKG
Sequence MDRHSSYFFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSA
CFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQ
NHSGPAMPTLECCH
EDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWF
RA
AVIAVPIAGGLILVLLIMLALRMLRSENKRLQDERQQMLSRLHYSFHG
HHSKKGQVAKLDLECMVPVSGQENCCLTCDKMRQAELSNEKILSLVHWGM
YSGHGKLEFI
Original MDRHSSYFFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSA
CFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCH
EDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWF
RAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDERQQMLSRLHYSFHG
HHSKKGQVAKLDLECMVPVSGQENCCLTCDKMRQAELSNEKILSLVHWGM
YSGHGKLEFI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11