Signal Peptide Database - Mammalia

 Entry Details
ID   72
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   O97759    (Created: 2005-11-22 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   BDNF_AILFU
Protein Name   Brain-derived neurotrophic factor
Gene   BDNF
Organism Scientific   Ailurus fulgens
Organism Common   Lesser panda
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Laurasiatheria
                  Carnivora
                    Caniformia
                      Ailuridae
                        Ailurus
Protein Length [aa]   247
Protein Mass [Da]   27870
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   18
chain   Brain-derived neurotrophic factor      129   247
disulfide bond      by similarity   141   208
disulfide bond      by similarity   186   237
disulfide bond      by similarity   196   239
glycosylation site   N-linked (GlcNAc...)   potential   121   121
site   Cleavage; by S1P   by similarity   57   58
propeptide      by similarity   19   128
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MTILFLTMVISYFGCMKA
Sequence MTILFLTMVISYFGCMKAAPMKEANVRGQGSLAYTGVRTHGTLESMNGPK
AGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQV
PLEPPLLFLLEEYKNYLDAANMSMRVRR
HSDPARRGELSVCDSISEWVTA
ADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETK
CNPMGYTKEGCRGID
KRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVC
TLTIKRGR
Original MTILFLTMVISYFGCMKAAPMKEANVRGQGSLAYTGVRTHGTLESMNGPK
AGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQV
PLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTA
ADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGID
KRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11