Signal Peptide Database - Mammalia

 Entry Details
ID   80
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P12643    (Created: 1989-10-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   BMP2_HUMAN
Protein Name   Bone morphogenetic protein 2
Gene   BMP2
Organism Scientific   Homo sapiens
Organism Common   Human
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Homo
Protein Length [aa]   396
Protein Mass [Da]   44702
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   23
chain   Bone morphogenetic protein 2      283   396
disulfide bond         296   361
disulfide bond         325   393
disulfide bond         329   395
disulfide bond   Interchain      360   360
glycosylation site   N-linked (GlcNAc...)   potential   135   135
glycosylation site   N-linked (GlcNAc...)   potential   163   163
glycosylation site   N-linked (GlcNAc...)   potential   164   164
glycosylation site   N-linked (GlcNAc...)   potential   200   200
sequence variant   (in dbSNP:rs11545591)      0   0
sequence variant   (in dbSNP:rs235768)      0   0
sequence variant   (in dbSNP:rs34183594)      0   0
sequence variant   (in dbSNP:rs2273074)      0   0
sequence variant   (in dbSNP:rs36105541)      0   0
sequence variant   (in dbSNP:rs2273073)      0   0
strand         295   299
strand         302   304
strand         314   316
strand         318   321
strand         324   326
strand         360   374
strand         380   396
helix         305   308
helix         335   337
helix         341   352
propeptide         24   282
turn         311   313
SP Length   23
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MVAGTRCLLALLLPQVLLGGAAG
Sequence MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVL
SEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLE
RAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAEL
QVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQN
ASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSL
HQDEHSWSQIRPLLVTFGHDGKGHPLHKREKR
QAKHKQRKRLKSSCKRHP
L
YVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVN
SV
NSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
Original MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVL
SEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLE
RAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAEL
QVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQN
ASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSL
HQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVN
SVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11