Signal Peptide Database - Mammalia

 Entry Details
ID   81
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P18075    (Created: 1990-11-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   BMP7_HUMAN
Protein Name   Bone morphogenetic protein 7
Gene   BMP7
Organism Scientific   Homo sapiens
Organism Common   Human
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Homo
Protein Length [aa]   431
Protein Mass [Da]   49313
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   29
chain   Bone morphogenetic protein 7      293   431
disulfide bond         330   396
disulfide bond         359   428
disulfide bond         363   430
disulfide bond   Interchain      395   395
glycosylation site   N-linked (GlcNAc...)   potential   187   187
glycosylation site   N-linked (GlcNAc...)   potential   302   302
glycosylation site   N-linked (GlcNAc...)   potential   321   321
glycosylation site   N-linked (GlcNAc...)   potential   372   372
strand         329   333
strand         336   338
strand         348   350
strand         352   355
strand         358   362
strand         396   409
strand         415   430
helix         339   342
helix         369   371
helix         375   386
propeptide         30   292
turn         345   347
turn         388   390
SP Length   29
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MHVRSLRAAAPHSFVALWAPLFLLRSALA
Sequence MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQE
RREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGG
QGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPR
YHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQE
HLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVE
TLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIR
STGSKQRS
Q
NRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIA
PEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQ
LNAISVLYF
DDSSNVILKKYRNMVVRACGCH
Original MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQE
RREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGG
QGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPR
YHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQE
HLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVE
TLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIA
PEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQ
LNAISVLYFDDSSNVILKKYRNMVVRACGCH
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11