Signal Peptide Database - Mammalia

 Entry Details
ID   85
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q64277    (Created: 1997-11-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   BST1_MOUSE
Protein Name   ADP-ribosyl cyclase 2
Gene   Bst1
Organism Scientific   Mus musculus
Organism Common   Mouse
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Mus
Protein Length [aa]   311
Protein Mass [Da]   34616
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   24
chain   ADP-ribosyl cyclase 2      25   286
disulfide bond      by similarity   46   60
disulfide bond      by similarity   76   156
disulfide bond      by similarity   137   150
disulfide bond      by similarity   231   252
disulfide bond      by similarity   264   273
glycosylation site   N-linked (GlcNAc...)   potential   59   59
glycosylation site   N-linked (GlcNAc...)   potential   88   88
glycosylation site   N-linked (GlcNAc...)   potential   141   141
glycosylation site   N-linked (GlcNAc...)   potential   185   185
propeptide      potential   287   311
lipid moiety-binding region   GPI-anchor amidated serine   potential   286   286
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAVQGGLLSLWLWLWLSLLTVLLG
Sequence MAVQGGLLSLWLWLWLSLLTVLLGARARWRGEGTTPHLQSIFLGRCAEYT
TLLSLGNK
NCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSL
FWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSW
CRQENASGLDYQSC
PTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFA
DFEIPYLQKDKVTRIEIWVMHDVGGPNVES
CGEGSVKILEDRLEALGFQH
SC
INDYRPVKFLMCVDHSTHPDCIMNSASASMRRESASLHAIGDASLLIS
LLVALASSSQA
Original MAVQGGLLSLWLWLWLSLLTVLLGARARWRGEGTTPHLQSIFLGRCAEYT
TLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSL
FWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSC
PTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFA
DFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQH
SCINDYRPVKFLMCVDHSTHPDCIMNSASASMRRESASLHAIGDASLLIS
LLVALASSSQA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11