Signal Peptide Database - Mammalia

 Entry Details
ID   89
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q02105    (Created: 1993-07-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   C1QC_MOUSE
Protein Name   Complement C1q subcomponent subunit C
Gene   C1qc
Organism Scientific   Mus musculus
Organism Common   Mouse
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Mus
Protein Length [aa]   246
Protein Mass [Da]   25966
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   29
chain   Complement C1q subcomponent subunit C      30   246
disulfide bond   Interchain   by similarity   33   33
domain   Collagen-like      32   113
domain   C1q      116   246
modified residue   4-hydroxyproline   by similarity   37   37
modified residue   4-hydroxyproline   by similarity   40   40
modified residue   4-hydroxyproline   by similarity   43   43
modified residue   4-hydroxyproline   by similarity   61   61
modified residue   4-hydroxyproline   by similarity   64   64
modified residue   5-hydroxylysine   by similarity   73   73
modified residue   5-hydroxylysine   by similarity   76   76
modified residue   4-hydroxyproline   by similarity   79   79
modified residue   4-hydroxyproline   by similarity   82   82
modified residue   4-hydroxyproline   by similarity   97   97
modified residue   4-hydroxyproline   by similarity   100   100
modified residue   4-hydroxyproline   by similarity   106   106
modified residue   4-hydroxyproline   by similarity   109   109
SP Length   29
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MVVGPSCQPQCGLCLLLLFLLALPLRSQA
Sequence MVVGPSCQPQCGLCLLLLFLLALPLRSQASAGCYGIPGMPGMPGAPGKDG
HDGLQGPKGE
PGIPAVPGTQGPKGQKGEPGMPGHRGKNGPRGTSGLPGDP
GPRGPPGEPGVEGRYKQKHQSVFTVTRQTTQYPEANALVRFNSVVTNPQG
HYNPSTGKFTCEVPGLYYFVYYTSHTANLCVHLNLNLARVASFCDHMFNS
KQVSSGGALLRLQRGDEVWLSVNDYNGMVGIEGSNSVFSGFLLFPD
Original MVVGPSCQPQCGLCLLLLFLLALPLRSQASAGCYGIPGMPGMPGAPGKDG
HDGLQGPKGEPGIPAVPGTQGPKGQKGEPGMPGHRGKNGPRGTSGLPGDP
GPRGPPGEPGVEGRYKQKHQSVFTVTRQTTQYPEANALVRFNSVVTNPQG
HYNPSTGKFTCEVPGLYYFVYYTSHTANLCVHLNLNLARVASFCDHMFNS
KQVSSGGALLRLQRGDEVWLSVNDYNGMVGIEGSNSVFSGFLLFPD
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11