Signal Peptide Database - Mammalia

 Entry Details
ID   90
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P60827    (Created: 2004-04-13 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   C1QT8_HUMAN
Protein Name   Complement C1q tumor necrosis factor-related protein 8
Gene   C1QTNF8
Organism Scientific   Homo sapiens
Organism Common   Human
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Homo
Protein Length [aa]   262
Protein Mass [Da]   28764
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   17
chain   Complement C1q tumor necrosis factor- related protein 8      18   262
domain   Collagen-like      69   111
domain   C1q      122   262
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAAPALLLLALLLPVGA
Sequence MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRG
DLWRGLPRVRPTIDIEIL
KGEKGEAGVRGRAGRSGKEGPPGARGLQGRRG
QKGQVGPPGAA
CRRAYAAFSVGRRAYAAFSVGRREGLHSSDHFQAVPFDT
ELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAA
VLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYIT
FSGHLVKPAAEL
Original MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRG
DLWRGLPRVRPTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRG
QKGQVGPPGAACRRAYAAFSVGRRAYAAFSVGRREGLHSSDHFQAVPFDT
ELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAA
VLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYIT
FSGHLVKPAAEL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11