Signal Peptide Database - Mammalia

 Entry Details
ID   93
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q5R9X1    (Created: 2005-11-08 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   CADH2_PONAB
Protein Name   Cadherin-2
Gene   CDH2
Organism Scientific   Pongo abelii
Organism Common   Sumatran orangutan
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Pongo
Protein Length [aa]   906
Protein Mass [Da]   99838
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   25
chain   Cadherin-2      160   906
transmembrane region      potential   725   745
topological domain   Extracellular   potential   160   724
topological domain   Cytoplasmic   potential   746   906
domain   Cadherin 1      160   267
domain   Cadherin 2      268   382
domain   Cadherin 3      383   497
domain   Cadherin 4      498   603
domain   Cadherin 5      604   710
modified residue   Phosphotyrosine   by similarity   785   785
glycosylation site   N-linked (GlcNAc...)   potential   190   190
glycosylation site   N-linked (GlcNAc...)   potential   273   273
glycosylation site   N-linked (GlcNAc...)   potential   325   325
glycosylation site   N-linked (GlcNAc...)   potential   402   402
glycosylation site   N-linked (GlcNAc...)   potential   572   572
glycosylation site   N-linked (GlcNAc...)   potential   622   622
glycosylation site   N-linked (GlcNAc...)   potential   651   651
glycosylation site   N-linked (GlcNAc...)   potential   692   692
propeptide      by similarity   26   159
compositionally biased region   Ser-rich      863   878
SP Length   25
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MCRIAGALRTLLPLLAALLQASVEA
Sequence MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVH
EGQPLLNVKFSNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHA
KFLIYAQEEETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKH
SGHLQRQKR
DWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP
GADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENP
IDIVINVIDMNDNRPEF
LHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRILSQAPSTPSPNMFTIN
NETGDIITVAAGLDREKVQQYTLIIQ
ATDMEGNPTYGLSNTATAIITVTDVNDNPPEF
TAMTFYGEVPENRVDVIV
A
NLTVTDKDQPHTPAWNAVYRISGGDPTGRFAIQTDPNSNDGLVTVVKPI
DFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYF
APN
PKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVN
GQITTIAVLDRESPNVKNNIY
NATFLASDNGIPPMSGTGTLQIYLLDIND
NAP
QVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKR
NWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKV
CQCDSNGDCT
DVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRD
KERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQD
YDLSQLQQPDTVEPDA
IKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAP
PYDSLLVFDYEG
SGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADM
YGGGDD
Original MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVH
EGQPLLNVKFSNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHA
KFLIYAQEEETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKH
SGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP
GADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENP
IDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQ
ATDMEGNPTYGLSNTATAIITVTDVNDNPPEFTAMTFYGEVPENRVDVIV
ANLTVTDKDQPHTPAWNAVYRISGGDPTGRFAIQTDPNSNDGLVTVVKPI
DFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPN
PKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVN
GQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKR
NWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKV
CQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRD
KERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDA
IKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAP
PYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADM
YGGGDD
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11