Signal Peptide Database - Mammalia

 Entry Details
ID   94
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   O54800    (Created: 2001-04-27 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CADH8_RAT
Protein Name   Cadherin-8
Gene   Cdh8
Organism Scientific   Rattus norvegicus
Organism Common   Rat
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Rattus
Protein Length [aa]   799
Protein Mass [Da]   88333
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   29
chain   Cadherin-8      62   799
transmembrane region      potential   622   642
topological domain   Extracellular   potential   62   621
topological domain   Cytoplasmic   potential   643   799
domain   Cadherin 1      62   167
domain   Cadherin 2      168   276
domain   Cadherin 3      277   391
domain   Cadherin 4      392   494
domain   Cadherin 5      495   616
glycosylation site   N-linked (GlcNAc...)   potential   188   188
glycosylation site   N-linked (GlcNAc...)   potential   463   463
glycosylation site   N-linked (GlcNAc...)   potential   473   473
glycosylation site   N-linked (GlcNAc...)   potential   544   544
splice variant   (in isoform 2)      0   0
splice variant   (in isoform 2)      533   799
propeptide      potential   30   61
SP Length   29
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MPERLAETLLDLWTPLIILWITLPSFVYM
Sequence MPERLAETLLDLWTPLIILWITLPSFVYMAPMNQAHVLTTGSPLELSRQS
EEMRILNRSKR
GWVWNQMFVLEEFSGPEPILVGRLHTDLDPGSKKIKYIL
SGDGAGTIFQINDITGDIHAIKRLDREEKAEYTLTAQAVDWETNKPLEPP
SEFIIKVQDINDNAPEF
LNGPYHATVPEMSILGTSVTNVTATDADDPVYG
NSAKLVYSILEGQPYFSIEPETAIIKTALPNMDREAKEEYLVVIQAKDMG
GHSGGLSGTTTLTVTLTDVNDNPPKF
AQSLYHFSVPEDVVLGTAIGRVKA
NDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGVIRLRKPLDFETKKS
YTLKVEAANIHIDPRFSGRGPFKDTATVKIVVEDADEPPVF
SSPTYLLEV
HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL
ATPLDRELSVWH
NISIIATEIRNHSQISRVPVAIKVLDVNDNAPEFASEY
EAFLCENGKPGQVIQTVSAMDKDDPKNGHFFL
YSLLPEMVNNPNFTIKKN
EDNSLSILAKHNGFNRQKQEVYLLPIVISDSGNPPLSSTSTLTIRVCGCS
NDGVVQSCNVEPYVLPIGLSMGALIAILACIILLLVIVVLFVTLRRHKNE
PLIIKDDEDVRENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRKDI
KPDLQFMPRQGLAPVPNGVDVDEFINVRLHEADNDPTAPPYDSIQIYGYE
GRGSVAGSLSSLESTTSDSDQNFDYLSDWGPRFKRLGELYSVGESDKET
Original MPERLAETLLDLWTPLIILWITLPSFVYMAPMNQAHVLTTGSPLELSRQS
EEMRILNRSKRGWVWNQMFVLEEFSGPEPILVGRLHTDLDPGSKKIKYIL
SGDGAGTIFQINDITGDIHAIKRLDREEKAEYTLTAQAVDWETNKPLEPP
SEFIIKVQDINDNAPEFLNGPYHATVPEMSILGTSVTNVTATDADDPVYG
NSAKLVYSILEGQPYFSIEPETAIIKTALPNMDREAKEEYLVVIQAKDMG
GHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTAIGRVKA
NDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGVIRLRKPLDFETKKS
YTLKVEAANIHIDPRFSGRGPFKDTATVKIVVEDADEPPVFSSPTYLLEV
HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL
ATPLDRELSVWHNISIIATEIRNHSQISRVPVAIKVLDVNDNAPEFASEY
EAFLCENGKPGQVIQTVSAMDKDDPKNGHFFLYSLLPEMVNNPNFTIKKN
EDNSLSILAKHNGFNRQKQEVYLLPIVISDSGNPPLSSTSTLTIRVCGCS
NDGVVQSCNVEPYVLPIGLSMGALIAILACIILLLVIVVLFVTLRRHKNE
PLIIKDDEDVRENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRKDI
KPDLQFMPRQGLAPVPNGVDVDEFINVRLHEADNDPTAPPYDSIQIYGYE
GRGSVAGSLSSLESTTSDSDQNFDYLSDWGPRFKRLGELYSVGESDKET
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11