Signal Peptide Database - Mammalia

 Entry Details
ID   95
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8NFZ8    (Created: 2007-06-26 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   CADM4_HUMAN
Protein Name   Cell adhesion molecule 4
Gene   CADM4
Organism Scientific   Homo sapiens
Organism Common   Human
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Homo
Protein Length [aa]   388
Protein Mass [Da]   42785
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   20
chain   Cell adhesion molecule 4      21   388
disulfide bond      by similarity   44   104
disulfide bond      by similarity   145   199
disulfide bond      by similarity   245   291
transmembrane region      potential   325   345
topological domain   Extracellular   potential   21   324
topological domain   Cytoplasmic   potential   346   388
domain   Ig-like V-type      21   119
domain   Ig-like C2-type 1      124   219
domain   Ig-like C2-type 2      224   307
glycosylation site   N-linked (GlcNAc...)   potential   31   31
glycosylation site   N-linked (GlcNAc...)   potential   67   67
glycosylation site   N-linked (GlcNAc...)   potential   286   286
sequence variant   (in dbSNP:rs34246023)      0   0
SP Length   20
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGRARRFQWPLLLLWAAAAG
Sequence MGRARRFQWPLLLLWAAAAGPGAGQEVQTENVTVAEGGVAEITCRLHQYD
GSIVVIQNPARQTLFF
NGTRALKDERFQLEEFSPRRVRIRLSDARLEDEG
GYFCQLYTEDTHHQIATLT
VLVAPENPVVEVREQAVEGGEVELSCLVPRS
RPAATLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICE
AQNQALPSGHSKQTQYVLD
VQYSPTARIHASQAVVREGDTLVLTCAVTGN
PRPNQIRWNRGNESLPERAEAVGETLTLPGLVSAD
NGTYTCEASNKHGHA
RALYVLV
VYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVR
QKGSYLTHEASGLDEQGEAREAFLNGSDGHKRKEEFFI
Original MGRARRFQWPLLLLWAAAAGPGAGQEVQTENVTVAEGGVAEITCRLHQYD
GSIVVIQNPARQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEG
GYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELSCLVPRS
RPAATLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICE
AQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGN
PRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHA
RALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVR
QKGSYLTHEASGLDEQGEAREAFLNGSDGHKRKEEFFI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11