Signal Peptide Database - Mammalia

 Entry Details
ID   98
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P01256    (Created: 1986-07-21 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CALCA_RAT
Protein Name   Calcitonin gene-related peptide 1
Gene   Calca
Organism Scientific   Rattus norvegicus
Organism Common   Rat
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Rattus
Protein Length [aa]   128
Protein Mass [Da]   13948
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   25
disulfide bond      by similarity   84   89
modified residue   Phenylalanine amide   by similarity   119   119
propeptide         26   80
propeptide         125   128
peptide   Calcitonin gene-related peptide 1. /FTId=PRO_0000004066      83   119
SP Length   25
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGFLKFSPFLVVSILLLYQACGLQA
Sequence MGFLKFSPFLVVSILLLYQACGLQAVPLRSTLESSPGMAATLSEEEARLL
LAALVQNYMQMKVRELEQEQEAEGSSVTAQ
KRSCNTATCVTHRLAGLLSR
SGGVVKDNFVPTNVGSEAF
GRRRRDLQA
Original MGFLKFSPFLVVSILLLYQACGLQAVPLRSTLESSPGMAATLSEEEARLL
LAALVQNYMQMKVRELEQEQEAEGSSVTAQKRSCNTATCVTHRLAGLLSR
SGGVVKDNFVPTNVGSEAFGRRRRDLQA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11