Signal Peptide Database - Viruses

 Entry Details
ID   1009
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q5UPU8    (Created: 2006-10-03 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   YL274_MIMIV
Protein Name   Uncharacterized protein L274
Gene   MIMI_L274
Organism Scientific   Acanthamoeba polyphaga mimivirus
Organism Common   APMV
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Mimiviridae
      Mimivirus
Protein Length [aa]   212
Protein Mass [Da]   23506
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   20
chain   Uncharacterized protein L274      21   212
SP Length   20
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKNLTIGAIFLIFFAVSAFA
Sequence MKNLTIGAIFLIFFAVSAFASAPCPKKLADTTCPREPYSFEGMKRQEPIK
GRNVGWFQCQATMTVHDPVTTAVLVTQPTFTFNLSTLYHNSCGCWKTVTT
IPGDAVKMEYGNGLPGQAMYGSCFYATWADLAGNPVETVGFARNVVGVHR
DLIYVSRATNELVVHQSIYPLGRDQVGDEYVLVRHFDPVTKGIDWVQAVY
CTKIQDQLEPLP
Original MKNLTIGAIFLIFFAVSAFASAPCPKKLADTTCPREPYSFEGMKRQEPIK
GRNVGWFQCQATMTVHDPVTTAVLVTQPTFTFNLSTLYHNSCGCWKTVTT
IPGDAVKMEYGNGLPGQAMYGSCFYATWADLAGNPVETVGFARNVVGVHR
DLIYVSRATNELVVHQSIYPLGRDQVGDEYVLVRHFDPVTKGIDWVQAVY
CTKIQDQLEPLP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11