Signal Peptide Database - Viruses

 Entry Details
ID   1010
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q5UQZ1    (Created: 2006-06-27 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   YL894_MIMIV
Protein Name   Putative truncated GMC-type inactive oxidoreductase L894
Gene   MIMI_L894
Organism Scientific   Acanthamoeba polyphaga mimivirus
Organism Common   APMV
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Mimiviridae
      Mimivirus
Protein Length [aa]   438
Protein Mass [Da]   48304
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   26
chain   Putative truncated GMC-type inactive oxidoreductase L894      27   438
nucleotide phosphate-binding region   FAD   by similarity   79   109
SP Length   26
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MYVFLLFSRYKIFYVYIKKMAHRSRC
Sequence MYVFLLFSRYKIFYVYIKKMAHRSRCNCNDTSNSNGSQHGINLPLRKIDT
YDPCVNCRVKPHLCPKPHPCPKPENLEA
DIVIIGAGAAGCVLAYYLTKFS
DLKIILLEA
GHTHFNDPVVTDPMGFFGKYNPPNENIRMSQNPSYAWQPAL
EPDTGAYSMRNVVAHGLAVGGSTAINQLNYIVGGRTVFDNDWPTGWKYDD
IKKYFRRVLADISPIRDGTKVNLTNTILESMRVLADQQVSSGVPVDFLIN
KATGGLPNIEQTYQGAPIVNLNDYEGINSVCGFKSYYVGVNQLSDGSYIR
KYAGNTYLNSYYVDSNGFGIGKFSNLRVISDAVVDRIHFEGQRAVSVTYI
DKKGNLHSVKVHKEVEICSGSFFTPTILQRSGIGDFSYLSSIGVPDLVYN
NPLVGQGLRNHYSPITQVSVTGPDAAAFLSNTAAGPTI
Original MYVFLLFSRYKIFYVYIKKMAHRSRCNCNDTSNSNGSQHGINLPLRKIDT
YDPCVNCRVKPHLCPKPHPCPKPENLEADIVIIGAGAAGCVLAYYLTKFS
DLKIILLEAGHTHFNDPVVTDPMGFFGKYNPPNENIRMSQNPSYAWQPAL
EPDTGAYSMRNVVAHGLAVGGSTAINQLNYIVGGRTVFDNDWPTGWKYDD
IKKYFRRVLADISPIRDGTKVNLTNTILESMRVLADQQVSSGVPVDFLIN
KATGGLPNIEQTYQGAPIVNLNDYEGINSVCGFKSYYVGVNQLSDGSYIR
KYAGNTYLNSYYVDSNGFGIGKFSNLRVISDAVVDRIHFEGQRAVSVTYI
DKKGNLHSVKVHKEVEICSGSFFTPTILQRSGIGDFSYLSSIGVPDLVYN
NPLVGQGLRNHYSPITQVSVTGPDAAAFLSNTAAGPTI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11