Signal Peptide Database - Viruses

 Entry Details
ID   1144
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9PYY5    (Created: 2001-02-21 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CATV_GVXN
Protein Name   Viral cathepsin
Gene   VCATH
Organism Scientific   Xestia c-nigrum granulosis virus
Organism Common   XnGV
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Baculoviridae
      Betabaculovirus
Protein Length [aa]   346
Protein Mass [Da]   38819
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   28
chain   Viral cathepsin      134   346
disulfide bond      by similarity   154   195
disulfide bond      by similarity   188   228
disulfide bond      by similarity   281   330
glycosylation site   N-linked (GlcNAc...)   potential   175   175
glycosylation site   N-linked (GlcNAc...)   potential   230   230
active site      by similarity   157   157
active site      by similarity   289   289
active site      by similarity   309   309
propeptide   Activation peptide   potential   29   133
SP Length   28
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLFFNFYKHIMFLPWVFCVALLTLNVCA
Sequence MLFFNFYKHIMFLPWVFCVALLTLNVCAVSYIAYDMSNAQELFNEFVVKY
NKVYKDDQEKEARFEIFKQNLADINARNALEDSAMFEINSRADISSNELL
QKLTGLKLSLMRGEKKNSFCTPTVISGDSSGKV
PDSFDWRDRNSVTSVKM
QKE
CGSCWAFSAVANIESLYHIKHNVSLDLSEQQLVDCDKVNNGCNGGLM
SWAFEGIIRAGGISYEAPYPYTGVDGVC
KNTTRYVQLSGCYAYDLRSEKK
LRQVLHEKGPVSVAIDVVDLTNYKSGVAKH
CSVDHGLNHGVLLVGYGQEN
DVKYWTLK
NSWGSDWGEQGFFRIKRDVNSCGILNQFAASAILSSSS
Original MLFFNFYKHIMFLPWVFCVALLTLNVCAVSYIAYDMSNAQELFNEFVVKY
NKVYKDDQEKEARFEIFKQNLADINARNALEDSAMFEINSRADISSNELL
QKLTGLKLSLMRGEKKNSFCTPTVISGDSSGKVPDSFDWRDRNSVTSVKM
QKECGSCWAFSAVANIESLYHIKHNVSLDLSEQQLVDCDKVNNGCNGGLM
SWAFEGIIRAGGISYEAPYPYTGVDGVCKNTTRYVQLSGCYAYDLRSEKK
LRQVLHEKGPVSVAIDVVDLTNYKSGVAKHCSVDHGLNHGVLLVGYGQEN
DVKYWTLKNSWGSDWGEQGFFRIKRDVNSCGILNQFAASAILSSSS
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11