Signal Peptide Database - Viruses

 Entry Details
ID   1165
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P09261    (Created: 1989-07-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CELF_VZVD
Protein Name   Cell fusion protein
Gene   5
Organism Scientific   Varicella-zoster virus (strain Dumas)
Organism Common   HHV-3
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Herpesvirales
      Herpesviridae
        Alphaherpesvirinae
          Varicellovirus
Protein Length [aa]   340
Protein Mass [Da]   38577
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
chain   Cell fusion protein      22   340
transmembrane region      potential   9   29
transmembrane region      potential   43   63
transmembrane region      potential   115   135
transmembrane region      potential   212   232
transmembrane region      potential   249   269
transmembrane region      potential   299   319
glycosylation site   N-linked (GlcNAc...)   potential   65   65
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MQALGIKTEHFIIMCLLSGHA
Sequence MQALGIKTEHFIIMCLLSGHAVFTLWYTARVKFEHECVYATTVINGGPVV
WGSYNNSLIYVTF
VNHSTFLDGLSGYDYSCRENLLSGDTMVKTAISTPLH
DKIRIVLGTRNCHA
YFWCVQLKMIFFAWFVYGMYLQFRRIRRMFGPFRSS
CELISPTSYSLNYVTRVISNILLGYPYTKLARLLCDVSMRRDGMSKVFNA
DPISFLYMHKG
VTLLMLLEVIAHISSGCIVLLTLGVAYTPCALLYPTYIR
ILAWVVVCTLAIVELISYV
RPKPTKDNHLNHINTGGIRGICTTCCATVMS
GLAIKCFYIVIFAIAVVIF
MHYEQRVQVSLFGESENSQKH
Original MQALGIKTEHFIIMCLLSGHAVFTLWYTARVKFEHECVYATTVINGGPVV
WGSYNNSLIYVTFVNHSTFLDGLSGYDYSCRENLLSGDTMVKTAISTPLH
DKIRIVLGTRNCHAYFWCVQLKMIFFAWFVYGMYLQFRRIRRMFGPFRSS
CELISPTSYSLNYVTRVISNILLGYPYTKLARLLCDVSMRRDGMSKVFNA
DPISFLYMHKGVTLLMLLEVIAHISSGCIVLLTLGVAYTPCALLYPTYIR
ILAWVVVCTLAIVELISYVRPKPTKDNHLNHINTGGIRGICTTCCATVMS
GLAIKCFYIVIFAIAVVIFMHYEQRVQVSLFGESENSQKH
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11