Signal Peptide Database - Viruses

 Entry Details
ID   1291
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P31626    (Created: 1993-07-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ENV_CAEVC
Protein Name   Envelope glycoprotein
Gene   env
Organism Scientific   Caprine arthritis encephalitis virus (strain Cork)
Organism Common   CAEV-Co
Lineage   Viruses
  Retro-transcribing viruses
    Retroviridae
      Orthoretrovirinae
        Lentivirus
          Ovine/caprine lentivirus group
Protein Length [aa]   966
Protein Mass [Da]   110291
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   83
chain   Envelope glycoprotein      84   966
chain   Surface protein   by similarity   84   632
chain   Transmembrane protein   by similarity   633   966
transmembrane region      potential   802   822
topological domain   Extracellular   potential   84   801
topological domain   Cytoplasmic   potential   823   966
region of interest   Fusion peptide   potential   633   653
region of interest   Immunosuppression   by similarity   699   715
glycosylation site   N-linked (GlcNAc...)   potential   101   101
glycosylation site   N-linked (GlcNAc...)   potential   134   134
glycosylation site   N-linked (GlcNAc...)   potential   179   179
glycosylation site   N-linked (GlcNAc...)   potential   220   220
glycosylation site   N-linked (GlcNAc...)   potential   231   231
glycosylation site   N-linked (GlcNAc...)   potential   334   334
glycosylation site   N-linked (GlcNAc...)   potential   351   351
glycosylation site   N-linked (GlcNAc...)   potential   357   357
glycosylation site   N-linked (GlcNAc...)   potential   382   382
glycosylation site   N-linked (GlcNAc...)   potential   403   403
glycosylation site   N-linked (GlcNAc...)   potential   407   407
glycosylation site   N-linked (GlcNAc...)   potential   438   438
glycosylation site   N-linked (GlcNAc...)   potential   443   443
glycosylation site   N-linked (GlcNAc...)   potential   449   449
glycosylation site   N-linked (GlcNAc...)   potential   459   459
glycosylation site   N-linked (GlcNAc...)   potential   469   469
glycosylation site   N-linked (GlcNAc...)   potential   483   483
glycosylation site   N-linked (GlcNAc...)   potential   495   495
glycosylation site   N-linked (GlcNAc...)   potential   505   505
glycosylation site   N-linked (GlcNAc...)   potential   511   511
glycosylation site   N-linked (GlcNAc...)   potential   529   529
glycosylation site   N-linked (GlcNAc...)   potential   536   536
site   Cleavage; by host   by similarity   632   633
coiled-coil region      potential   665   715
coiled-coil region      potential   756   791
SP Length   83
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MDAGARYMRLTGKENWVEVTMDGEKERKREGFTAGQQGKYNPQVSKNIGN
RNTNDCFAYKGIFLWRISLTMWILLGINMCVSA
Sequence MDAGARYMRLTGKENWVEVTMDGEKERKREGFTAGQQGKYNPQVSKNIGN
RNTNDCFAYKGIFLWRISLTMWILLGINMCVSA
EDYITLISDPYGFSPIK
NVSGVPVTCVTKEFAKWGCQPLGAYPDPEIEYRNVSQEVVKEVYQENWPW
NTYHWPLWQMENVRYWLKENMQENQQRK
NNTKEGIEELLAGTIRGRFCVP
YPFALLKCTKWCWYTAAIN
NESGKAGKIKINCTEARAVSCTEDMPLASIQ
RAYWDEKDRESMAFMNIKACDSNLRCQKRPGGCMEGYPIPVGAEIIPESM
KYLRGAKSQYGGIKDKNGELKLPLTLRVWVKLA
NVSEWVNGTPPDWQDRI
NGSKGINGTLWGELNSMHHLGFALSQNGKWCNYTGEIKLGQETFQYHYKP
NW
NCTGNWTQYPVWQVIRNLDMVEHMTGECVQRPQRHNITVGNGTITGNC
STTNWDGC
NCSRSGNYLYNSSEGGLLLILCRQNSTLTRILGTNTNWTTMW
GIYK
NCSGCENATLDNTGEGTLGGVANKNCSLPHKNESNKWTCAPRQRDG
KTDSLYIAGGKKFWTRIKAQFSCESNIGQLDGMLHQQILLQKYQVIKVRA
YTYGVIEMPENYAKTRIINRKKRELSHKRKK
RGVGLVIMLVIMAIVAAAG
ASL
GVANAIQQSYTKAAVQTLANATAAQQDVLEATYAMVQHVAKGVRILE
ARVARVEAITDRIML
YQELDCWHYHQYCITSTKTEVAKYINWTRFKDNCT
WQQWE
RGLQGYDTNLTILLKESAAMTQLAEEQARRIPEVWESLKDVFDWS
G
WFSWLKYIPIIVVGLLGCILIRAVICVCQPLVEIYRTLSTPTYQRVTVI
METRADVAGENQDFGDGLEESDNSETSERVTVQKAWSRAWELWQNSPWKE
PWKRGLLRLLVLPLTMGIWINGWLGEHHKNKKRKGGLETWHKKGTDIGLG
QIPVDHLWCYKKSKSL
Original MDAGARYMRLTGKENWVEVTMDGEKERKREGFTAGQQGKYNPQVSKNIGN
RNTNDCFAYKGIFLWRISLTMWILLGINMCVSAEDYITLISDPYGFSPIK
NVSGVPVTCVTKEFAKWGCQPLGAYPDPEIEYRNVSQEVVKEVYQENWPW
NTYHWPLWQMENVRYWLKENMQENQQRKNNTKEGIEELLAGTIRGRFCVP
YPFALLKCTKWCWYTAAINNESGKAGKIKINCTEARAVSCTEDMPLASIQ
RAYWDEKDRESMAFMNIKACDSNLRCQKRPGGCMEGYPIPVGAEIIPESM
KYLRGAKSQYGGIKDKNGELKLPLTLRVWVKLANVSEWVNGTPPDWQDRI
NGSKGINGTLWGELNSMHHLGFALSQNGKWCNYTGEIKLGQETFQYHYKP
NWNCTGNWTQYPVWQVIRNLDMVEHMTGECVQRPQRHNITVGNGTITGNC
STTNWDGCNCSRSGNYLYNSSEGGLLLILCRQNSTLTRILGTNTNWTTMW
GIYKNCSGCENATLDNTGEGTLGGVANKNCSLPHKNESNKWTCAPRQRDG
KTDSLYIAGGKKFWTRIKAQFSCESNIGQLDGMLHQQILLQKYQVIKVRA
YTYGVIEMPENYAKTRIINRKKRELSHKRKKRGVGLVIMLVIMAIVAAAG
ASLGVANAIQQSYTKAAVQTLANATAAQQDVLEATYAMVQHVAKGVRILE
ARVARVEAITDRIMLYQELDCWHYHQYCITSTKTEVAKYINWTRFKDNCT
WQQWERGLQGYDTNLTILLKESAAMTQLAEEQARRIPEVWESLKDVFDWS
GWFSWLKYIPIIVVGLLGCILIRAVICVCQPLVEIYRTLSTPTYQRVTVI
METRADVAGENQDFGDGLEESDNSETSERVTVQKAWSRAWELWQNSPWKE
PWKRGLLRLLVLPLTMGIWINGWLGEHHKNKKRKGGLETWHKKGTDIGLG
QIPVDHLWCYKKSKSL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11