Signal Peptide Database - Viruses

 Entry Details
ID   137
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P68331    (Created: 2004-11-09 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CELF_HHV11
Protein Name   Cell fusion protein
Gene   SYN
Organism Scientific   Human herpesvirus 1 (strain 17)
Organism Common   HHV-1
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Herpesvirales
      Herpesviridae
        Alphaherpesvirinae
          Simplexvirus
Protein Length [aa]   338
Protein Mass [Da]   37573
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   30
chain   Cell fusion protein      31   338
transmembrane region      potential   123   139
transmembrane region      potential   222   238
transmembrane region      potential   249   265
transmembrane region      potential   307   323
glycosylation site   N-linked (GlcNAc...)   potential   48   48
glycosylation site   N-linked (GlcNAc...)   potential   58   58
SP Length   30
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLAVRSLQHLSTVVLITAYGLVLVWYTVFG
Sequence MLAVRSLQHLSTVVLITAYGLVLVWYTVFGASPLHRCIYAVRPTGTNNDT
ALVWMKM
NQTLLFLGAPTHPPNGGWRNHAHICYANLIAGRVVPFQVPPDA
MNRRIMNVHEAVNCLETLWYTR
VRLVVVGWFLYLAFVALHQRRCMFGVVS
PAHKMVAPATYLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQNLVQLF
ETDPVTFLYHRPAIGVIVGCE
LMLRFVAVGLIVGTAFISRGACAITYPLF
LTITTWCFVSTIGLT
ELYCILRRGPAPKNADKAAAPGRSKGLSGVCGRCC
SIILSG
IAVRLCYIAVVAGVVLVALHYEQEIQRRLFDV
Original MLAVRSLQHLSTVVLITAYGLVLVWYTVFGASPLHRCIYAVRPTGTNNDT
ALVWMKMNQTLLFLGAPTHPPNGGWRNHAHICYANLIAGRVVPFQVPPDA
MNRRIMNVHEAVNCLETLWYTRVRLVVVGWFLYLAFVALHQRRCMFGVVS
PAHKMVAPATYLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQNLVQLF
ETDPVTFLYHRPAIGVIVGCELMLRFVAVGLIVGTAFISRGACAITYPLF
LTITTWCFVSTIGLTELYCILRRGPAPKNADKAAAPGRSKGLSGVCGRCC
SIILSGIAVRLCYIAVVAGVVLVALHYEQEIQRRLFDV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11