Signal Peptide Database - Viruses

 Entry Details
ID   162
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P25129    (Created: 1992-05-01 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   COATA_BPPF1
Protein Name   Probable coat protein A
Gene   III
Organism Scientific   Pseudomonas phage Pf1
Organism Common   Bacteriophage Pf1
Lineage   Viruses
  ssDNA viruses
    Inoviridae
      Inovirus
Protein Length [aa]   437
Protein Mass [Da]   44800
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   31
chain   Probable coat protein A      32   437
compositionally biased region   Gly-rich      266   320
SP Length   31
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MSIKTLISVLRVTLLTACLLPSLFFVRSAIA
Sequence MSIKTLISVLRVTLLTACLLPSLFFVRSAIAGPYIWEVVMYSSSGSSTPA
EACEKARVVADRSPDWNYTSATPKMNGLDNSYCSVVYVSRRDPSVVNTCD
DCASWKLFRKGDQCANADDTYNASTGICEPPPKECKEGELFPAKGPDSPV
VTSGGRNYVGDGGAPTACYQSCEYGGNPSPASCYLVKGSTTTGFCNYILK
GTGQSCGADSYTFSQTGDSLNPPDTPNTDPSDPNDPGCPPGWSWSGTTCV
KTPTDPTDPTDPTTP
GGDGGGDGNGGGNNNGGGNDGGTGNGDGSGGGDGN
GAGDGSGDGDGSGTGGDGNG
TCDPAKENCSTGPEGPGGELKEPTPGTWDD
AIATWEKKVEEAKKELKTKVKANVDQMKGAFDLNLAEGGGQLPCESMTIW
GKSYSLCISDYAGQLSSLRVALLLMAALIAALILLKD
Original MSIKTLISVLRVTLLTACLLPSLFFVRSAIAGPYIWEVVMYSSSGSSTPA
EACEKARVVADRSPDWNYTSATPKMNGLDNSYCSVVYVSRRDPSVVNTCD
DCASWKLFRKGDQCANADDTYNASTGICEPPPKECKEGELFPAKGPDSPV
VTSGGRNYVGDGGAPTACYQSCEYGGNPSPASCYLVKGSTTTGFCNYILK
GTGQSCGADSYTFSQTGDSLNPPDTPNTDPSDPNDPGCPPGWSWSGTTCV
KTPTDPTDPTDPTTPGGDGGGDGNGGGNNNGGGNDGGTGNGDGSGGGDGN
GAGDGSGDGDGSGTGGDGNGTCDPAKENCSTGPEGPGGELKEPTPGTWDD
AIATWEKKVEEAKKELKTKVKANVDQMKGAFDLNLAEGGGQLPCESMTIW
GKSYSLCISDYAGQLSSLRVALLLMAALIAALILLKD
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11