Signal Peptide Database - Viruses

 Entry Details
ID   178
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P68636    (Created: 2004-12-07 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   CRMB_CAMPM
Protein Name   Soluble TNF receptor II
Gene   CRMB1
Organism Scientific   Camelpox virus (strain M-96)
Organism Common  
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Poxviridae
      Chordopoxvirinae
        Orthopoxvirus
Protein Length [aa]   349
Protein Mass [Da]   38065
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Soluble TNF receptor II      20   349
disulfide bond      by similarity   32   43
disulfide bond      by similarity   44   57
disulfide bond      by similarity   47   65
disulfide bond      by similarity   68   83
disulfide bond      by similarity   86   100
disulfide bond      by similarity   90   108
glycosylation site   N-linked (GlcNAc...)   potential   101   101
glycosylation site   N-linked (GlcNAc...)   potential   189   189
glycosylation site   N-linked (GlcNAc...)   potential   248   248
repeat   TNFR-Cys 1      31   65
repeat   TNFR-Cys 2      67   108
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKSVLYSYILFLSCIIING
Sequence MKSVLYSYILFLSCIIINGRDVTPYAPSNGKCKDNEYKRHNLCCLSCPPG
TYASRLCDSKTNTQC
TPCGSGTFTSRNNHLPACLSCNGRCDSNQVETRSC
NTTHNRIC
ECSPGYYCILKGSSGCKACVSQTKCGIGYGVSGHTSAGDVIC
SPCGLGTYSRTVSSADKCEPVPSNTFNYIDVEINLYPV
NDTSCTRTTTTG
ISESISTSELTITMNHKDCDPVFREEYFSVLNKVATSGFFTGENRYQ
NIS
KVCTLNFEIKCNNKGSSSKQLTKAKNDDGIMPHSETVTLVGDCLSSVDIY
ILYSNTNTQDYETDTISYHAGNVLDVDSHMPGSCDIHKLITNSKPTHFL
Original MKSVLYSYILFLSCIIINGRDVTPYAPSNGKCKDNEYKRHNLCCLSCPPG
TYASRLCDSKTNTQCTPCGSGTFTSRNNHLPACLSCNGRCDSNQVETRSC
NTTHNRICECSPGYYCILKGSSGCKACVSQTKCGIGYGVSGHTSAGDVIC
SPCGLGTYSRTVSSADKCEPVPSNTFNYIDVEINLYPVNDTSCTRTTTTG
ISESISTSELTITMNHKDCDPVFREEYFSVLNKVATSGFFTGENRYQNIS
KVCTLNFEIKCNNKGSSSKQLTKAKNDDGIMPHSETVTLVGDCLSSVDIY
ILYSNTNTQDYETDTISYHAGNVLDVDSHMPGSCDIHKLITNSKPTHFL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11