Signal Peptide Database - Viruses

 Entry Details
ID   217959
Source Database   UniProtKB/TrEMBL
UniProtKB/TrEMBL Accession Number   Q20W30    (Created: 2006-04-18 Updated: 2008-12-16)
UniProtKB/TrEMBL Entry Name   Q20W30_9INFA
Protein Name   n/a
Gene   HA
Organism Scientific   Influenza A virus
Organism Common   A/mallard/Alberta/149/2002(H2N4)
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   562
Protein Mass [Da]   63282
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   15
chain      potential   16   562
chain   HA1      16   340
chain   HA2      341   562
SP Length   15
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MTITFLILLFTVVKG
Sequence MTITFLILLFTVVKGDQICIGYHANNSTEKVDTILERNVTVTHAKDILEK
THNGKLCRLNGIPPLELGDCSIAGWLLGNPECDRLLSVPEWSYIVEKENP
VNGLCYPGSFNDYEELKHLLTSVTHFEKVKILPRDQWTQHTTTGGSRACA
VFGNPSFFRNMVWLTKKGSNYPIAKRSYNNTSGXQMLVIWGIHHPNDDEE
QRTLYQNVGTYVSVGTSTLNKRSIPEIATRPKVNGQGGRMEFSWTLLETW
DVINFESTGNLIAPEYGFKISKRGSSGIMKTEKTLENCETKCQTPLGAIN
TTLPFHNIHPLTIGECPKYVKSDRLVLATGLRNVPQIESR
GLFGAIAGFI
EGGWQGMVDGWYGYHHSNDQGSGYAADKESTQKAIDGITNKVNSVIEKMN
TQFEAVGKEFNNLERRLENLNKKMEDGFLDVWTYNAELLVLMENERTLDF
HDSNVKNLYDKVRMQLRDNAKEIGNGCFEFYHKCDDECMNSVKNGTYDYP
KYEEESKLNRNEIKGVKLSNMGVYQILAIYATVAGSLSLAIMIAGISFWM
CSNGSLQCRICI
Original MTITFLILLFTVVKGDQICIGYHANNSTEKVDTILERNVTVTHAKDILEK
THNGKLCRLNGIPPLELGDCSIAGWLLGNPECDRLLSVPEWSYIVEKENP
VNGLCYPGSFNDYEELKHLLTSVTHFEKVKILPRDQWTQHTTTGGSRACA
VFGNPSFFRNMVWLTKKGSNYPIAKRSYNNTSGXQMLVIWGIHHPNDDEE
QRTLYQNVGTYVSVGTSTLNKRSIPEIATRPKVNGQGGRMEFSWTLLETW
DVINFESTGNLIAPEYGFKISKRGSSGIMKTEKTLENCETKCQTPLGAIN
TTLPFHNIHPLTIGECPKYVKSDRLVLATGLRNVPQIESRGLFGAIAGFI
EGGWQGMVDGWYGYHHSNDQGSGYAADKESTQKAIDGITNKVNSVIEKMN
TQFEAVGKEFNNLERRLENLNKKMEDGFLDVWTYNAELLVLMENERTLDF
HDSNVKNLYDKVRMQLRDNAKEIGNGCFEFYHKCDDECMNSVKNGTYDYP
KYEEESKLNRNEIKGVKLSNMGVYQILAIYATVAGSLSLAIMIAGISFWM
CSNGSLQCRICI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11