Signal Peptide Database - Viruses

 Entry Details
ID   217967
Source Database   UniProtKB/TrEMBL
UniProtKB/TrEMBL Accession Number   A9L7U7    (Created: 2008-02-05 Updated: 2009-01-20)
UniProtKB/TrEMBL Entry Name   A9L7U7_9INFA
Protein Name   n/a
Gene   HA
Organism Scientific   Influenza A virus
Organism Common   A/Ohio/UR06-0411/2007(H1N1)
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   565
Protein Mass [Da]   63283
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   17
chain      potential   18   565
chain   HA1      18   343
chain   HA2      344   565
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKVKLLVLLCTFTATYA
Sequence MKVKLLVLLCTFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLL
EDSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISKESWSYIVETP
NPENGTCYPGYFADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSA
SCSHNGRSSFYRNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPN
IGDQRALYHTENAYVSVVSSHYSRRFTPEIAKRPKVRDQEGRINYYWTLL
EPGDTIIFEANGNLIAPRFAFALSRGFGSGIITSNAPMDECDAKCQTPQG
AINSSLPFQNVHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSR
GLFGAIA
GFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIE
KMNTQFTAVGKEFNKLERRMENLNKKVDDGFLDIWTYNAELLVLLENERT
LDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGTY
DYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAIS
FWMCSNGSLQCRICI
Original MKVKLLVLLCTFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLL
EDSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISKESWSYIVETP
NPENGTCYPGYFADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSA
SCSHNGRSSFYRNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPN
IGDQRALYHTENAYVSVVSSHYSRRFTPEIAKRPKVRDQEGRINYYWTLL
EPGDTIIFEANGNLIAPRFAFALSRGFGSGIITSNAPMDECDAKCQTPQG
AINSSLPFQNVHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIA
GFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIE
KMNTQFTAVGKEFNKLERRMENLNKKVDDGFLDIWTYNAELLVLLENERT
LDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGTY
DYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAIS
FWMCSNGSLQCRICI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11