Signal Peptide Database - Viruses

 Entry Details
ID   217975
Source Database   UniProtKB/TrEMBL
UniProtKB/TrEMBL Accession Number   B5FVT9    (Created: 2008-10-14 Updated: 2008-11-25)
UniProtKB/TrEMBL Entry Name   B5FVT9_9INFA
Protein Name   n/a
Gene   HA
Organism Scientific   Influenza A virus
Organism Common   A/Washington/AF1886/2008(H1N1)
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   350
Protein Mass [Da]   38776
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   17
chain      potential   18   350
chain   HA1      18   343
non-terminal residue         350   350
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKVKLLVLLCTFAATYA
Sequence MKVKLLVLLCTFAATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLL
ENSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISKESWSYIVEKP
NPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSA
SCSHNGESSFYRNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPN
IGDQKALYHTENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLL
EPGDTIIFEANGNLIAPRYAFALSRGFGSGIINSNAPMDKCDAKCQTPQG
AINSSLPFQNVHPVTIGECPKYVRSAKLRMVTGLRNIPSIQSR
GLFGAIA
Original MKVKLLVLLCTFAATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLL
ENSHNGKLCLLKGIAPLQLGNCSVAGWILGNPECELLISKESWSYIVEKP
NPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKESSWPNHTVTGVSA
SCSHNGESSFYRNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVHHPPN
IGDQKALYHTENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLL
EPGDTIIFEANGNLIAPRYAFALSRGFGSGIINSNAPMDKCDAKCQTPQG
AINSSLPFQNVHPVTIGECPKYVRSAKLRMVTGLRNIPSIQSRGLFGAIA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11