Signal Peptide Database - Viruses

 Entry Details
ID   217981
Source Database   UniProtKB/TrEMBL
UniProtKB/TrEMBL Accession Number   Q0A3Y4    (Created: 2006-10-17 Updated: 2008-12-16)
UniProtKB/TrEMBL Entry Name   Q0A3Y4_9INFA
Protein Name   n/a
Gene   HA
Organism Scientific   Influenza A virus
Organism Common   A/chicken/Chis/15224/1997(H5N2)
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   564
Protein Mass [Da]   63920
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   16
chain      potential   17   564
chain   HA1      17   342
chain   HA2      343   564
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKRIVIAFAIISIVTG
Sequence MKRIVIAFAIISIVTGDQICIGYHANNSTKQVDTIMEKNVTVTHAQDILE
KEHNGRLCSLKGVKPLILKDCSVAGWLLGNPMCDEFLNVPEWSYIVEKDN
PSNGLCYPGNFDDYEELKHLMSSTNHFEKIQIFPRSSWSDHDASSGVSSA
CPYNGRSSFFRNVVWLIKKNNVYRTIKRNYTNTNVEDLLILWGIHHPNDA
XEQIKLYQNPNTYVSVGTSTLNQRSIPKIATRPKVNGQSGRMEFFWTILR
PNDSIFFESTGNFIAPEYAYKIIKKGNSAVMKSELDYGNCNAKCQTPVGA
INSSLPFHNVHPFTIGECPRYVKSKKLVLATGLRNVPQRETR
GLFGAIAG
FIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGITNKVNSIIDK
MNTQFEAVGKEFNNLERRIENLNKKMEDDFLDVWTYNAELLVLMENERTL
DLHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYD
YPQYSKESRLKREEIDGVKLESTGTYQILSIYSTVVSSLALAIMVAGLSF
WMCSNGSLQCRICI
Original MKRIVIAFAIISIVTGDQICIGYHANNSTKQVDTIMEKNVTVTHAQDILE
KEHNGRLCSLKGVKPLILKDCSVAGWLLGNPMCDEFLNVPEWSYIVEKDN
PSNGLCYPGNFDDYEELKHLMSSTNHFEKIQIFPRSSWSDHDASSGVSSA
CPYNGRSSFFRNVVWLIKKNNVYRTIKRNYTNTNVEDLLILWGIHHPNDA
XEQIKLYQNPNTYVSVGTSTLNQRSIPKIATRPKVNGQSGRMEFFWTILR
PNDSIFFESTGNFIAPEYAYKIIKKGNSAVMKSELDYGNCNAKCQTPVGA
INSSLPFHNVHPFTIGECPRYVKSKKLVLATGLRNVPQRETRGLFGAIAG
FIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGITNKVNSIIDK
MNTQFEAVGKEFNNLERRIENLNKKMEDDFLDVWTYNAELLVLMENERTL
DLHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYD
YPQYSKESRLKREEIDGVKLESTGTYQILSIYSTVVSSLALAIMVAGLSF
WMCSNGSLQCRICI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11