Signal Peptide Database - Viruses

 Entry Details
ID   217982
Source Database   UniProtKB/TrEMBL
UniProtKB/TrEMBL Accession Number   A8C0Y4    (Created: 2007-11-13 Updated: 2008-12-16)
UniProtKB/TrEMBL Entry Name   A8C0Y4_9INFA
Protein Name   n/a
Gene   HA
Organism Scientific   Influenza A virus
Organism Common   A/pheasant/Shantou/17033/2005(H9N2)
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   535
Protein Mass [Da]   59835
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   18
chain      potential   19   535
chain   HA1      19   338
chain   HA2      339   535
non-terminal residue         535   535
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide METIPLMTILLMVTAINA
Sequence METIPLMTILLMVTAINADKICIGYQSTNSTETVDTLTETNVPVTQAKEL
LHTEHNGMLCATNLGHPLILDTCTIEGLIYGNPSCDLLLGGREWSYIVER
PSAVNGMCYPGNVENLEELRLLFSSASSYQRVQIFPDTIWNVTYSGTSSA
CSNSFYRSMRWLTQKDNTYPVQDAQYTNNRGKSILFMWGINHPPTDTVQT
NLYTRTDTTTSVTTEDINRAFKPVIGPRPLVNGLQGRIDYYWSVLKPGQT
LRVKSNGNLIAPWYGHILSGESHGRILKSDLNSGNCVVQCQTERGGLNTT
LPFHNVSKYAFGNCPKYVGVKSLKLAVGMRNVPARSSR
GLFGAIAGFIEG
GWPGLVAGWYGFQHSNDQGVGMAADRDSTQKAIDKITSKVNNIVDKMNKQ
YEIIDHEFSEIETRLNMINNKIDDQIQDIWAYNAELLVLLENQKTLDEHD
ANVNNLYNKVKRALGSNAIEDGKGCFELYHKCDDQCMETIRNGTYNRGKY
KEESRLERQKIEGVKLESEGTYKILTIYSTVASS
L
Original METIPLMTILLMVTAINADKICIGYQSTNSTETVDTLTETNVPVTQAKEL
LHTEHNGMLCATNLGHPLILDTCTIEGLIYGNPSCDLLLGGREWSYIVER
PSAVNGMCYPGNVENLEELRLLFSSASSYQRVQIFPDTIWNVTYSGTSSA
CSNSFYRSMRWLTQKDNTYPVQDAQYTNNRGKSILFMWGINHPPTDTVQT
NLYTRTDTTTSVTTEDINRAFKPVIGPRPLVNGLQGRIDYYWSVLKPGQT
LRVKSNGNLIAPWYGHILSGESHGRILKSDLNSGNCVVQCQTERGGLNTT
LPFHNVSKYAFGNCPKYVGVKSLKLAVGMRNVPARSSRGLFGAIAGFIEG
GWPGLVAGWYGFQHSNDQGVGMAADRDSTQKAIDKITSKVNNIVDKMNKQ
YEIIDHEFSEIETRLNMINNKIDDQIQDIWAYNAELLVLLENQKTLDEHD
ANVNNLYNKVKRALGSNAIEDGKGCFELYHKCDDQCMETIRNGTYNRGKY
KEESRLERQKIEGVKLESEGTYKILTIYSTVASSL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11