Signal Peptide Database - Viruses

 Entry Details
ID   217984
Source Database   UniProtKB/TrEMBL
UniProtKB/TrEMBL Accession Number   B2B952    (Created: 2008-05-20 Updated: 2008-12-16)
UniProtKB/TrEMBL Entry Name   B2B952_9INFA
Protein Name   n/a
Gene   HA
Organism Scientific   Influenza A virus
Organism Common   A/duck/Vietnam/55/2007(H5N1)
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   564
Protein Mass [Da]   63766
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   16
chain      potential   17   564
chain   HA1      17   345
chain   HA2      346   564
non-terminal residue         564   564
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MEKIVLLLAIISLVKS
Sequence MEKIVLLLAIISLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILE
KTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKAN
PANDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSA
CPYQGVPSFFRNVVWLIKKNNTYPTIKRSYNNTNQEDLLILWGIHHSNDA
AEQTKLYQNPTTYISVGTSTLNQRLVPKIATRSKVNGQSGRMDFFWTILK
PNDAINFESNGNFIAPEYAYKIVKKGDSAIMKSEVEYGNCNTKCQTPIGA
INSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNSPLRERRRKR
GLFGA
IAGFIEGGWQGMVDGWYGFHHSNEQGSGYAADKESTQKAIDGVTNKVNSI
IDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNG
TYDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAG
LSLWMCSNGSLQC
R
Original MEKIVLLLAIISLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILE
KTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKAN
PANDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSA
CPYQGVPSFFRNVVWLIKKNNTYPTIKRSYNNTNQEDLLILWGIHHSNDA
AEQTKLYQNPTTYISVGTSTLNQRLVPKIATRSKVNGQSGRMDFFWTILK
PNDAINFESNGNFIAPEYAYKIVKKGDSAIMKSEVEYGNCNTKCQTPIGA
INSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNSPLRERRRKRGLFGA
IAGFIEGGWQGMVDGWYGFHHSNEQGSGYAADKESTQKAIDGVTNKVNSI
IDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNG
TYDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAG
LSLWMCSNGSLQCR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11