Signal Peptide Database - Viruses

 Entry Details
ID   217986
Source Database   UniProtKB/TrEMBL
UniProtKB/TrEMBL Accession Number   B6JRK4    (Created: 2008-12-16 Updated: 2008-12-16)
UniProtKB/TrEMBL Entry Name   B6JRK4_9INFA
Protein Name   n/a
Gene   HA
Organism Scientific   Influenza A virus
Organism Common   A/blue-winged teal/Texas/Sg-00208/2007(H4N6)
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   549
Protein Mass [Da]   61624
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   11
chain      potential   12   549
chain   HA1      12   338
chain   HA2      339   549
non-terminal residue         1   1
non-terminal residue         549   549
SP Length   11
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide ILFLLIAEVSS
Sequence ILFLLIAEVSSQNYTGNPVICLGHHAVPNGTMVKTLTDDQIEVVAAQELV
ESQHLPELCPSPLRLVDGQTCDIVNGALGSPGCDHLNGAEWDVFIERPTA
VDTCYPFDVPDYQSLRSILANNGKFEFIAEEFQWSTVKQNGKSGACKRAN
VNDFFNRLNWLTKSDGNAYPLQNLTKINNGDYARLYIWGVHHPSTDTEQT
NLYKNNPGRVTVSTKTSQTSVVPNIGSRPWVRGQSGRISFYWTIVEPGDL
IVFNTIGNLIAPRGHYKLNSQKKSTILNTAVPIGSCVSKCHTDRGSITTT
KPFQNISRISIGDCPKYVKQGSLKLATGMRNIPEKATR
GLFGAIAGFIEN
GWQGLIDGWYGFRHQNAEGTGTAADLKSTQAAIDQINGKLNRLIEKTNEK
YHQIEKEFEQVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDVTD
SEMNKLFERVRRQLRENAEDKGNGCFEIFHQCDNNCIESIRNGTYDHDIY
RDEAINNRFQIQGVKLTQGYKDIILWISFSISCFLLVALLLAFILWAC
Q
Original ILFLLIAEVSSQNYTGNPVICLGHHAVPNGTMVKTLTDDQIEVVAAQELV
ESQHLPELCPSPLRLVDGQTCDIVNGALGSPGCDHLNGAEWDVFIERPTA
VDTCYPFDVPDYQSLRSILANNGKFEFIAEEFQWSTVKQNGKSGACKRAN
VNDFFNRLNWLTKSDGNAYPLQNLTKINNGDYARLYIWGVHHPSTDTEQT
NLYKNNPGRVTVSTKTSQTSVVPNIGSRPWVRGQSGRISFYWTIVEPGDL
IVFNTIGNLIAPRGHYKLNSQKKSTILNTAVPIGSCVSKCHTDRGSITTT
KPFQNISRISIGDCPKYVKQGSLKLATGMRNIPEKATRGLFGAIAGFIEN
GWQGLIDGWYGFRHQNAEGTGTAADLKSTQAAIDQINGKLNRLIEKTNEK
YHQIEKEFEQVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDVTD
SEMNKLFERVRRQLRENAEDKGNGCFEIFHQCDNNCIESIRNGTYDHDIY
RDEAINNRFQIQGVKLTQGYKDIILWISFSISCFLLVALLLAFILWACQ
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11