Signal Peptide Database - Viruses

 Entry Details
ID   217987
Source Database   UniProtKB/TrEMBL
UniProtKB/TrEMBL Accession Number   Q67043    (Created: 1996-11-01 Updated: 2008-12-16)
UniProtKB/TrEMBL Entry Name   Q67043_9INFA
Protein Name   n/a
Gene  
Organism Scientific   Influenza A virus
Organism Common   A/duck/WI/1938/80 (H1N1)
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   566
Protein Mass [Da]   63170
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   17
chain   hemagglutinin      18   566
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MEAKLFVLFCTFTVLKA
Sequence MEAKLFVLFCTFTVLKADTICVGYHANNSTDTVDTVLEKNVTVTHSVNLL
EDSHNGKLCSLNGIAPLQLGKCNVAGWLLGNPECDLLLTANSWSYIIETS
NSENGTCYPGEFIDYEELREQLSSVSSFEKFEIFPKASSWPNHETTKGVT
AACSYSGASSFYRNLLWITKKGTSYPKLSKSYTNNKGKEVLVLWGVHHPP
TTSEQQSLYQNADAYVSVGSSKYNRRFTPEIAARPKVRGQAGRMNYYWTL
LDQGDTITFEATGNLIAPWYAFALNKGSDSGIITSDAPVHNCDTRCQTPH
GALNSSLPFQNVHPITIGECPKYIKSTKLRMATGLRNVPSIQSRGLFGAI
AGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVI
EKMNTQFTAVGKEFNNLERRIENLNKKVDDGFLDVWTYNAELLVLLENER
TLDFHDSNVRNLYEKVKSQLRNNAKELGNGCFEFYHKCDDECMEREKNGT
YDYPKYSEESKLNREEIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAI
SFWMCSNGSLQCRICI
Original MEAKLFVLFCTFTVLKADTICVGYHANNSTDTVDTVLEKNVTVTHSVNLL
EDSHNGKLCSLNGIAPLQLGKCNVAGWLLGNPECDLLLTANSWSYIIETS
NSENGTCYPGEFIDYEELREQLSSVSSFEKFEIFPKASSWPNHETTKGVT
AACSYSGASSFYRNLLWITKKGTSYPKLSKSYTNNKGKEVLVLWGVHHPP
TTSEQQSLYQNADAYVSVGSSKYNRRFTPEIAARPKVRGQAGRMNYYWTL
LDQGDTITFEATGNLIAPWYAFALNKGSDSGIITSDAPVHNCDTRCQTPH
GALNSSLPFQNVHPITIGECPKYIKSTKLRMATGLRNVPSIQSRGLFGAI
AGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVI
EKMNTQFTAVGKEFNNLERRIENLNKKVDDGFLDVWTYNAELLVLLENER
TLDFHDSNVRNLYEKVKSQLRNNAKELGNGCFEFYHKCDDECMEREKNGT
YDYPKYSEESKLNREEIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAI
SFWMCSNGSLQCRICI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11