Signal Peptide Database - Viruses

 Entry Details
ID   217997
Source Database   UniProtKB/TrEMBL
UniProtKB/TrEMBL Accession Number   B4URK4    (Created: 2008-09-23 Updated: 2008-12-16)
UniProtKB/TrEMBL Entry Name   B4URK4_9INFA
Protein Name   n/a
Gene   HA
Organism Scientific   Influenza A virus
Organism Common   A/cinnamon teal/California/HKWF1111/2007(H5N7)
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   564
Protein Mass [Da]   63499
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   16
chain      potential   17   564
chain   HA1      17   342
chain   HA2      343   564
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MERVVIALAIISIVKG
Sequence MERVVIALAIISIVKGDQICIGYHANNSTEQVDTIMEKNVTVTHAKDILE
REHNGKLCSLQGVRPLILKDCSVAGWLLGNPRCDEFLNVPEWSYIVEKDN
PINGLCYPGDFNDYGELKHLLSSTNHFEKVQIIPRSSWSNHDASSGVSSA
CPYNGRSAFFRNVVWLVKKNNAYPTIKRTYNNTNVEDLLILWGIHHPNDA
AEQTKLYQNSNTYVSVGTSTLNQRSIPEIATRPKVNGQSGRMEFFWTVLR
PNDAISFESNGNFIAPEYAYKIVKKGDSAIMKSELDYGNCDTKCQTPVGA
INSSMPFHNVHPLTIGECPKYVKSDKLVLATGLRNVPQKETR
GLFGAIAG
FIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGITNKVNSIIDK
MNTQFEAVGKEFSNLERRIENLNKKMEDGFLDLWTYNAELLVLMENERTL
DFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDDECMESVRNGTYD
YPQYSEESRLNREEIDGVKLESMGTYQILSIYSTVASSLALAIMIAGLSF
WMCSNGSLQCRICI
Original MERVVIALAIISIVKGDQICIGYHANNSTEQVDTIMEKNVTVTHAKDILE
REHNGKLCSLQGVRPLILKDCSVAGWLLGNPRCDEFLNVPEWSYIVEKDN
PINGLCYPGDFNDYGELKHLLSSTNHFEKVQIIPRSSWSNHDASSGVSSA
CPYNGRSAFFRNVVWLVKKNNAYPTIKRTYNNTNVEDLLILWGIHHPNDA
AEQTKLYQNSNTYVSVGTSTLNQRSIPEIATRPKVNGQSGRMEFFWTVLR
PNDAISFESNGNFIAPEYAYKIVKKGDSAIMKSELDYGNCDTKCQTPVGA
INSSMPFHNVHPLTIGECPKYVKSDKLVLATGLRNVPQKETRGLFGAIAG
FIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGITNKVNSIIDK
MNTQFEAVGKEFSNLERRIENLNKKMEDGFLDLWTYNAELLVLMENERTL
DFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDDECMESVRNGTYD
YPQYSEESRLNREEIDGVKLESMGTYQILSIYSTVASSLALAIMIAGLSF
WMCSNGSLQCRICI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11