Signal Peptide Database - Viruses

 Entry Details
ID   266
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P51519    (Created: 1996-10-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ENV_BLV
Protein Name   Envelope glycoprotein
Gene   env
Organism Scientific   Bovine leukemia virus
Organism Common   BLV
Lineage   Viruses
  Retro-transcribing viruses
    Retroviridae
      Orthoretrovirinae
        Deltaretrovirus
Protein Length [aa]   515
Protein Mass [Da]   58640
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   33
chain   Envelope glycoprotein      34   515
chain   Surface protein   by similarity   34   301
chain   Transmembrane protein   by similarity   302   515
disulfide bond   Alternate   by similarity   212   215
disulfide bond   Interchain (between SU and TM chains, or C-215 with C-392); alternate   by similarity   212   392
disulfide bond      by similarity   384   391
transmembrane region      potential   437   457
topological domain   Extracellular   potential   1   436
topological domain   Cytoplasmic   potential   458   515
region of interest   Fusion peptide   potential   304   324
region of interest   Immunosuppression   by similarity   365   381
glycosylation site   N-linked (GlcNAc...)   potential   129   129
glycosylation site   N-linked (GlcNAc...)   potential   203   203
glycosylation site   N-linked (GlcNAc...)   potential   230   230
glycosylation site   N-linked (GlcNAc...)   potential   251   251
glycosylation site   N-linked (GlcNAc...)   potential   256   256
glycosylation site   N-linked (GlcNAc...)   potential   271   271
glycosylation site   N-linked (GlcNAc...)   potential   287   287
glycosylation site   N-linked (GlcNAc...)   potential   351   351
glycosylation site   N-linked (GlcNAc...)   potential   398   398
site   Cleavage; by host   by similarity   301   302
short sequence motif   CXXC      212   215
short sequence motif   CX6CC      384   392
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   455   455
coiled-coil region      potential   330   376
coiled-coil region      potential   388   420
SP Length   33
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MPKERRSRRRPQPIIRWVSLTLTLLALCQPIQT
Sequence MPKERRSRRRPQPIIRWVSLTLTLLALCQPIQTWRCSLSLGNQQWMTTYN
QEAKFSISIDQILEAHNQSPFCPRSPRYTLDFVNGYPKIYWPPPQGRRRF
GARAMVTYDCEPRCPYVGADHFDCPHWD
NASQADQGSFYVNHQILFLHLK
QCHGIFTLTWEIWGYDPLITFSLHKIPDPPQPDFPQLNSDWVPSVRSWAL
LL
NQTARAFPDCAICWEPSPPWAPEILVYNKTISGSGPGLALPDAQIFWV
NTSLFNTTQGWHHPSQRLLFNVSQGNALLLPPISLVNLSTVSSAPPTRVR
RSPVAALTLGLALSVGLTGINVAVSALSHQRLTSLIHVLEQDQQRLITAI
NQTHYNLLNVASVVAQNRRGLDWLYI
RLGFQSLCPTINEPCCFLRIQNDS
IIRLGDLQPLSQRVSTDWQW
PWNWDLGLTAWVRETIHSVLSLFLLALFLL
FLAP
CLIKCLTSRLLKLLRQAPHFPEISFPPKPDSDYQALLPSAPEIYSH
LSPTKPDYINLRPCP
Original MPKERRSRRRPQPIIRWVSLTLTLLALCQPIQTWRCSLSLGNQQWMTTYN
QEAKFSISIDQILEAHNQSPFCPRSPRYTLDFVNGYPKIYWPPPQGRRRF
GARAMVTYDCEPRCPYVGADHFDCPHWDNASQADQGSFYVNHQILFLHLK
QCHGIFTLTWEIWGYDPLITFSLHKIPDPPQPDFPQLNSDWVPSVRSWAL
LLNQTARAFPDCAICWEPSPPWAPEILVYNKTISGSGPGLALPDAQIFWV
NTSLFNTTQGWHHPSQRLLFNVSQGNALLLPPISLVNLSTVSSAPPTRVR
RSPVAALTLGLALSVGLTGINVAVSALSHQRLTSLIHVLEQDQQRLITAI
NQTHYNLLNVASVVAQNRRGLDWLYIRLGFQSLCPTINEPCCFLRIQNDS
IIRLGDLQPLSQRVSTDWQWPWNWDLGLTAWVRETIHSVLSLFLLALFLL
FLAPCLIKCLTSRLLKLLRQAPHFPEISFPPKPDSDYQALLPSAPEIYSH
LSPTKPDYINLRPCP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11