Signal Peptide Database - Viruses

 Entry Details
ID   267
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q02077    (Created: 1993-10-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ENV_FLVCS
Protein Name   Envelope glycoprotein
Gene  
Organism Scientific   Feline leukemia virus (strain C/FS246)
Organism Common  
Lineage   Viruses
  Retro-transcribing viruses
    Retroviridae
      Orthoretrovirinae
        Gammaretrovirus
Protein Length [aa]   436
Protein Mass [Da]   47445
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   1
chain   Surface protein   by similarity   2   415
chain   Transmembrane protein   by similarity   416   436
disulfide bond      by similarity   95   117
disulfide bond      by similarity   109   122
topological domain   Extracellular   potential   1   436
glycosylation site   N-linked (GlcNAc...)   potential   3   3
glycosylation site   N-linked (GlcNAc...)   potential   11   11
glycosylation site   N-linked (GlcNAc...)   potential   26   26
glycosylation site   N-linked (GlcNAc...)   potential   59   59
glycosylation site   N-linked (GlcNAc...)   potential   237   237
glycosylation site   N-linked (GlcNAc...)   potential   272   272
glycosylation site   N-linked (GlcNAc...)   potential   277   277
glycosylation site   N-linked (GlcNAc...)   potential   304   304
glycosylation site   N-linked (GlcNAc...)   potential   344   344
glycosylation site   N-linked (GlcNAc...)   potential   360   360
glycosylation site   N-linked (GlcNAc...)   potential   380   380
site   Cleavage; by host   by similarity   415   416
short sequence motif   CXXC      282   285
non-terminal residue         1   1
non-terminal residue         436   436
SP Length   1
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide M
Sequence MANPSPHQIYNVTWVITNVQTNTQANATSMLGTLTDAYPTLHVDLCDLVG
DTWEPIVL
NPTSVRPGAVLLSSSPKYGCKTTDRKKQQQTYPFYVCPGHAP
SLGPKGTHCGGAQDGFCAAWGCETTGEAWWKPTSSWDYITVKRGSSPDNS
CEGKCNPLVLQFTQKGRQASWDGPKMWGLRLYRTGYDPIALFTVSRQVST
ITPPQAMGPNLVLPDQKPPSRQSQTGSKVATQRPQT
NESAPRSVGPTTMG
PKRIGTGDRLINLVQGTYLAL
NATDPNKTKDCWLCLVSRPPYYEGIAILG
NYS
NQTNPPPSCLSTPQHKLTISEVSGQGLCIGTVPKTHQALCNKTQQGH
TGAHYLAAP
NGTYWACNTGLTPCISMAVLNWTSDFCVLIELWPRVTYHQP
EYVYTHFAKAVRFR
REPISLTVALMLGGLTVGGIAA
Original MANPSPHQIYNVTWVITNVQTNTQANATSMLGTLTDAYPTLHVDLCDLVG
DTWEPIVLNPTSVRPGAVLLSSSPKYGCKTTDRKKQQQTYPFYVCPGHAP
SLGPKGTHCGGAQDGFCAAWGCETTGEAWWKPTSSWDYITVKRGSSPDNS
CEGKCNPLVLQFTQKGRQASWDGPKMWGLRLYRTGYDPIALFTVSRQVST
ITPPQAMGPNLVLPDQKPPSRQSQTGSKVATQRPQTNESAPRSVGPTTMG
PKRIGTGDRLINLVQGTYLALNATDPNKTKDCWLCLVSRPPYYEGIAILG
NYSNQTNPPPSCLSTPQHKLTISEVSGQGLCIGTVPKTHQALCNKTQQGH
TGAHYLAAPNGTYWACNTGLTPCISMAVLNWTSDFCVLIELWPRVTYHQP
EYVYTHFAKAVRFRREPISLTVALMLGGLTVGGIAA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11