Signal Peptide Database - Viruses

 Entry Details
ID   327
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P09458    (Created: 1989-07-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   FUS_MUMPR
Protein Name   Fusion glycoprotein F0
Gene   F
Organism Scientific   Mumps virus (strain RW)
Organism Common  
Lineage   Viruses
  ssRNA negative-strand viruses
    Mononegavirales
      Paramyxoviridae
        Paramyxovirinae
          Rubulavirus
Protein Length [aa]   538
Protein Mass [Da]   58761
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   19
chain   Fusion glycoprotein F0      20   538
chain   Fusion glycoprotein F2      20   102
chain   Fusion glycoprotein F1      103   538
disulfide bond   Interchain (between F2 and F1 chains)   by similarity   64   185
disulfide bond      by similarity   324   333
disulfide bond      by similarity   348   356
disulfide bond      by similarity   380   385
disulfide bond      by similarity   387   410
transmembrane region      potential   487   507
topological domain   Extracellular   by similarity   20   486
topological domain   Cytoplasmic   by similarity   508   538
region of interest   Fusion peptide   by similarity   103   127
glycosylation site   N-linked (GlcNAc...)   potential   73   73
glycosylation site   N-linked (GlcNAc...)   potential   182   182
glycosylation site   N-linked (GlcNAc...)   potential   352   352
glycosylation site   N-linked (GlcNAc...)   potential   427   427
glycosylation site   N-linked (GlcNAc...)   potential   433   433
glycosylation site   N-linked (GlcNAc...)   potential   457   457
site   Cleavage; by host   by similarity   102   103
coiled-coil region      potential   128   156
coiled-coil region      potential   452   477
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKAFSVTCLGFAVFSSSIC
Sequence MKAFSVTCLGFAVFSSSICVNINILQQIGYIKQQVRQLSYYSQSSSSYIV
VKLLPNIQPTDNSCEFKSVTQY
NKTLSNLLLPIAENINNIASPSPGSRRH
K
RFAGIAIGIAALGVATAAQVTAAVSLVQAQTNARAIAAMKNSIQATNRA
IFEVKE
GTQQLAIAVQAIQDHINTIMNTQLNNMSCQILDNQLATYLGLYL
TELTTVFQPQLINPALSPISIQALRSLLGSMTPAVVQATLSTSISAAEIL
SAGLMEGQIVSVLLDEMQMIVKINIPTIVTQSNALVIDFYSISSFINNQE
SIIQLPDRILEIGNEQWSYPAKNCKLTRHHIFCQYNEAERLSLESKLCLA
G
NISACVFSPIAGSYMRRFVALDGTIVANCRSLTCLCKSPSYPIYQPDHH
AVTTIDLTTCQTLSLDGLDFSIVSLS
NITYAENLTISLSQTINTQPIDIS
T
ELSKVNASLQNAVKYIKESNHQLQSVSVNSKIGAIIVAALVLSILSIII
SLLFCCW
AYIATKEIRRINFKTNHINTISSSVDDLIRY
Original MKAFSVTCLGFAVFSSSICVNINILQQIGYIKQQVRQLSYYSQSSSSYIV
VKLLPNIQPTDNSCEFKSVTQYNKTLSNLLLPIAENINNIASPSPGSRRH
KRFAGIAIGIAALGVATAAQVTAAVSLVQAQTNARAIAAMKNSIQATNRA
IFEVKEGTQQLAIAVQAIQDHINTIMNTQLNNMSCQILDNQLATYLGLYL
TELTTVFQPQLINPALSPISIQALRSLLGSMTPAVVQATLSTSISAAEIL
SAGLMEGQIVSVLLDEMQMIVKINIPTIVTQSNALVIDFYSISSFINNQE
SIIQLPDRILEIGNEQWSYPAKNCKLTRHHIFCQYNEAERLSLESKLCLA
GNISACVFSPIAGSYMRRFVALDGTIVANCRSLTCLCKSPSYPIYQPDHH
AVTTIDLTTCQTLSLDGLDFSIVSLSNITYAENLTISLSQTINTQPIDIS
TELSKVNASLQNAVKYIKESNHQLQSVSVNSKIGAIIVAALVLSILSIII
SLLFCCWAYIATKEIRRINFKTNHINTISSSVDDLIRY
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11