Signal Peptide Database - Viruses

 Entry Details
ID   360
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P52514    (Created: 1996-10-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   GL_MCMVS
Protein Name   Glycoprotein L
Gene   GL
Organism Scientific   Murine cytomegalovirus (strain Smith)
Organism Common  
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Herpesvirales
      Herpesviridae
        Betaherpesvirinae
          Muromegalovirus
Protein Length [aa]   274
Protein Mass [Da]   31221
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   17
chain   Glycoprotein L      18   274
glycosylation site   N-linked (GlcNAc...)   potential   48   48
glycosylation site   N-linked (GlcNAc...)   potential   64   64
glycosylation site   N-linked (GlcNAc...)   potential   116   116
glycosylation site   N-linked (GlcNAc...)   potential   170   170
glycosylation site   N-linked (GlcNAc...)   potential   199   199
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MMPLLLLILLSTRNLLG
Sequence MMPLLLLILLSTRNLLGAAQSQESPVAGERRALDLTTVYVLPRSEPINAT
VEHKCREALASCY
NGSEFQPLHDDGPIRPDPYRFSTMIRFKRSYGELPLP
IELNDEFLEQLSLLH
NNTDQLRVLLTLMRTSRASDWMSFLGGYTQCDAPK
SVVFTCVESVCYEHDLMRL
NYTTDLFTENVLGLDVSPPVLSVLVLLRNNH
TKAESVVRVPTSSMSLLDGTYNLLRTILGHMSLDTDLIGVLRSYRDRFPA
VFSVSDQIKITRQHYRPQYQRKRP
Original MMPLLLLILLSTRNLLGAAQSQESPVAGERRALDLTTVYVLPRSEPINAT
VEHKCREALASCYNGSEFQPLHDDGPIRPDPYRFSTMIRFKRSYGELPLP
IELNDEFLEQLSLLHNNTDQLRVLLTLMRTSRASDWMSFLGGYTQCDAPK
SVVFTCVESVCYEHDLMRLNYTTDLFTENVLGLDVSPPVLSVLVLLRNNH
TKAESVVRVPTSSMSLLDGTYNLLRTILGHMSLDTDLIGVLRSYRDRFPA
VFSVSDQIKITRQHYRPQYQRKRP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11