Signal Peptide Database - Viruses

 Entry Details
ID   391
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9QAQ9    (Created: 2003-06-16 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   HEMA_CVBOK
Protein Name   Hemagglutinin-esterase
Gene   HE
Organism Scientific   Bovine coronavirus (strain OK-0514)
Organism Common   BCoV
Lineage   Viruses
  ssRNA positive-strand viruses, no DNA stage
    Nidovirales
      Coronaviridae
        Coronavirus
          Coronavirus group 2
            Coronavirus group 2a
Protein Length [aa]   424
Protein Mass [Da]   47648
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   18
chain   Hemagglutinin-esterase      19   424
transmembrane region      potential   393   413
topological domain   Extracellular   potential   19   392
topological domain   Cytoplasmic   potential   414   424
region of interest   Esterase domain first part   by similarity   7   127
region of interest   Receptor binding   by similarity   128   266
region of interest   Esterase domain second part   by similarity   267   379
glycosylation site   N-linked (GlcNAc...)   potential   54   54
glycosylation site   N-linked (GlcNAc...)   potential   89   89
glycosylation site   N-linked (GlcNAc...)   potential   153   153
glycosylation site   N-linked (GlcNAc...)   potential   236   236
glycosylation site   N-linked (GlcNAc...)   potential   301   301
glycosylation site   N-linked (GlcNAc...)   potential   316   316
glycosylation site   N-linked (GlcNAc...)   potential   358   358
active site   Nucleophile   by similarity   40   40
active site   Charge relay system   by similarity   228   228
active site   Charge relay system   by similarity   329   329
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MFLLPRFVLVSCIIGSLG
Sequence MFLLPRFVLVSCIIGSLGFDNPPTNVVSHLNGDWFLFGDSRSDCNHVVTT
NPR
NYSYMDLNPALCGSGKISSKAGNSIFRSFHFTDFYNYTGEGQQIIFY
EGVNFTPYHAFKCTTSGSNDIWMQNKG
LFYTQVYKNMAVYRSLTFVNVPY
VY
NGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCDEY
IVPLCIFNGKFLSNTKYYDDSQYYFNK
DTGVIYGLNSTETITTGFDFNCH
YLVLPSGNYLAISNEL
LLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSD
NMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSILSGLLYDSPCFSQ
QGVFRYD
NVSSVWPLYPYGRCPTAADINTPDVPICVYDPLPIILLGILLS
VAVIIIVVLLLYF
MVDNGTRLHDA
Original MFLLPRFVLVSCIIGSLGFDNPPTNVVSHLNGDWFLFGDSRSDCNHVVTT
NPRNYSYMDLNPALCGSGKISSKAGNSIFRSFHFTDFYNYTGEGQQIIFY
EGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMAVYRSLTFVNVPY
VYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCDEY
IVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCH
YLVLPSGNYLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSD
NMTAVACQPPYCYFRNSTTNYVGVYDINHGDAGFTSILSGLLYDSPCFSQ
QGVFRYDNVSSVWPLYPYGRCPTAADINTPDVPICVYDPLPIILLGILLS
VAVIIIVVLLLYFMVDNGTRLHDA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11