Signal Peptide Database - Viruses

 Entry Details
ID   395
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q6LEJ4    (Created: 2007-03-06 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   HEMA_I80A2
Protein Name   Hemagglutinin
Gene   HA
Organism Scientific   Influenza A virus (strain A/Seal/Massachusetts/1/1980 H7N7)
Organism Common  
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   560
Protein Mass [Da]   62168
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   18
chain   Hemagglutinin HA1 chain      19   338
chain   Hemagglutinin HA2 chain      340   560
disulfide bond   Interchain (between HA1 and HA2 chains)   by similarity   22   476
disulfide bond      by similarity   60   286
disulfide bond      by similarity   72   84
disulfide bond      by similarity   105   147
disulfide bond      by similarity   290   314
disulfide bond      by similarity   483   487
transmembrane region      potential   524   544
topological domain   Extracellular   potential   19   523
topological domain   Cytoplasmic   potential   545   560
glycosylation site   N-linked (GlcNAc...)   potential   30   30
glycosylation site   N-linked (GlcNAc...)   potential   46   46
glycosylation site   N-linked (GlcNAc...)   potential   141   141
glycosylation site   N-linked (GlcNAc...)   potential   249   249
glycosylation site   N-linked (GlcNAc...)   potential   421   421
glycosylation site   N-linked (GlcNAc...)   potential   493   493
sequence variant   (in strain: SC35M mouse- adapted)      0   0
sequence variant   (in strain: SC35M mouse-adapted)      0   0
sequence variant   (in strain: SC35M mouse-adapted)      0   0
sequence variant   (in strain: SC35M mouse-adapted)      0   0
site   Cleavage; by host   by similarity   339   340
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   548   548
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   556   556
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   559   559
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNTQILVFIACVLIEAKG
Sequence MNTQILVFIACVLIEAKGDKICLGHHAVANGTKVNTLTERGIEVVNATET
VETANIGKICTQGKRPTDLGQCGLLGTLIGPPQCDQFLEFESNLIIERRE
GNDVCYPGKFTNEESLRQILRGSGGVDKESMGFTYSGIRT
NGTTSACRRS
GSSFYAEMKWLLSNSDNAAFPQMTKSYRNPRNKPALIVWGIHHSGSTTEQ
TRLYGSGNKLITVGSSKYQQSFTPSPGARPQVNGQSGRIDFHWLLLDP
ND
TVTFTFNGAFIAPNRASFFRGESLGVQSDVPLDSNCGGDCFHSGGTIVSS
LPFQNINSRTVGKCPRYVKQPSLLLATGMRNVPENPKT
RGLFGAIAGFIE
NGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIDKTNQ
QFELIDNEFNEIEQQIGNVI
NWTRDSMTEVWSYNAELLVAMENQHTIDLA
DSEMNKLYERVRKQLRENAEEDGTGCFEIFHKCDDQCMESIR
NNTYDHTQ
YRAKSLQNRIQIDPVKLSSGYKD
IILWFSFGASCFLLLAIAMGLVFICIK
NGNMR
CTICI
Original MNTQILVFIACVLIEAKGDKICLGHHAVANGTKVNTLTERGIEVVNATET
VETANIGKICTQGKRPTDLGQCGLLGTLIGPPQCDQFLEFESNLIIERRE
GNDVCYPGKFTNEESLRQILRGSGGVDKESMGFTYSGIRTNGTTSACRRS
GSSFYAEMKWLLSNSDNAAFPQMTKSYRNPRNKPALIVWGIHHSGSTTEQ
TRLYGSGNKLITVGSSKYQQSFTPSPGARPQVNGQSGRIDFHWLLLDPND
TVTFTFNGAFIAPNRASFFRGESLGVQSDVPLDSNCGGDCFHSGGTIVSS
LPFQNINSRTVGKCPRYVKQPSLLLATGMRNVPENPKTRGLFGAIAGFIE
NGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIDKTNQ
QFELIDNEFNEIEQQIGNVINWTRDSMTEVWSYNAELLVAMENQHTIDLA
DSEMNKLYERVRKQLRENAEEDGTGCFEIFHKCDDQCMESIRNNTYDHTQ
YRAKSLQNRIQIDPVKLSSGYKDIILWFSFGASCFLLLAIAMGLVFICIK
NGNMRCTICI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11