Signal Peptide Database - Viruses

 Entry Details
ID   396
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P09344    (Created: 1989-07-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   HEMA_I85A6
Protein Name   Hemagglutinin
Gene   HA
Organism Scientific   Influenza A virus (strain A/Starling/Victoria/5156/1985 H7N7)
Organism Common  
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   563
Protein Mass [Da]   62730
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   18
chain   Hemagglutinin HA1 chain      19   335
chain   Hemagglutinin HA2 chain      343   563
disulfide bond   Interchain (between HA1 and HA2 chains)   by similarity   22   479
disulfide bond      by similarity   60   286
disulfide bond      by similarity   72   84
disulfide bond      by similarity   105   147
disulfide bond      by similarity   290   314
disulfide bond      by similarity   486   490
transmembrane region      potential   527   547
topological domain   Extracellular   potential   19   526
topological domain   Cytoplasmic   potential   548   563
glycosylation site   N-linked (GlcNAc...)   potential   30   30
glycosylation site   N-linked (GlcNAc...)   potential   46   46
glycosylation site   N-linked (GlcNAc...)   potential   249   249
glycosylation site   N-linked (GlcNAc...)   potential   424   424
glycosylation site   N-linked (GlcNAc...)   potential   496   496
site   Cleavage; by host   by similarity   342   343
propeptide   Connecting peptide      336   342
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   551   551
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   559   559
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   562   562
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNTQILILTLVAAIHTNA
Sequence MNTQILILTLVAAIHTNADKICLGHHAVSNGTKVNTLTERGVEVVNATET
VERRTIPRICTKGKKAIDLGQCGLLGIITGPPQCDQFLEFTADLIIERRE
GNDVCYPGKFVNEEALRQILRESGGINKETTGFTYSGIRTNGVTSACRRS
GSSFYAEMKWLLSNTDNAAFPQMTKSYKNTRNEPALIVWGIHHSGSATEQ
TKLYGSGNKLITVGSSNYQQSFVPSPGARPQVNGQSGRIDFHWLILNP
ND
TVTFSFNGAFVAPDRVSFFKGKSMGIQSEVPVDTNCEGECYHNGGTITSN
LPFQNVNSRAVGKCPRYVKQKSLLLATGMKNVPEI
PKKREKRGLFGAIAG
FIENGWEGLVDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIEK
TNQQFELIDNEFTEVEKQIGNVI
NWTRDSITEVWSYNADLLVAMENQHTI
DLTDSEMNKLYERVRRQLRENAEEDCTGCFEIFHKCDDDCMASIR
NNTYD
HSTYREEAMQNRVKIDPVKLSSGYKD
VILWFSLGASCFLLLAIAMGLVFM
CVKNGNMRCTICI
Original MNTQILILTLVAAIHTNADKICLGHHAVSNGTKVNTLTERGVEVVNATET
VERRTIPRICTKGKKAIDLGQCGLLGIITGPPQCDQFLEFTADLIIERRE
GNDVCYPGKFVNEEALRQILRESGGINKETTGFTYSGIRTNGVTSACRRS
GSSFYAEMKWLLSNTDNAAFPQMTKSYKNTRNEPALIVWGIHHSGSATEQ
TKLYGSGNKLITVGSSNYQQSFVPSPGARPQVNGQSGRIDFHWLILNPND
TVTFSFNGAFVAPDRVSFFKGKSMGIQSEVPVDTNCEGECYHNGGTITSN
LPFQNVNSRAVGKCPRYVKQKSLLLATGMKNVPEIPKKREKRGLFGAIAG
FIENGWEGLVDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIEK
TNQQFELIDNEFTEVEKQIGNVINWTRDSITEVWSYNADLLVAMENQHTI
DLTDSEMNKLYERVRRQLRENAEEDCTGCFEIFHKCDDDCMASIRNNTYD
HSTYREEAMQNRVKIDPVKLSSGYKDVILWFSLGASCFLLLAIAMGLVFM
CVKNGNMRCTICI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11