Signal Peptide Database - Viruses

 Entry Details
ID   397
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P68762    (Created: 1988-08-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   HEMA_INCAA
Protein Name   Hemagglutinin-esterase-fusion glycoprotein
Gene   HE
Organism Scientific   Influenza C virus (strain C/Ann Arbor/1/1950)
Organism Common  
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus C
Protein Length [aa]   655
Protein Mass [Da]   71956
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   14
chain   Hemagglutinin-esterase-fusion glycoprotein chain 1      15   446
chain   Hemagglutinin-esterase-fusion glycoprotein chain 2      447   655
disulfide bond   Interchain (between HEF1 and HEF2 chains)   by similarity   20   583
disulfide bond      by similarity   120   165
disulfide bond      by similarity   140   188
disulfide bond      by similarity   210   252
disulfide bond      by similarity   229   316
disulfide bond      by similarity   237   289
transmembrane region      potential   631   651
topological domain   Extracellular   potential   14   630
topological domain   Cytoplasmic   potential   652   655
region of interest   Fusion domain-1   by similarity   15   40
region of interest   Esterase domain-1   by similarity   41   151
region of interest   N-acetyl-9-O-acetylneuraminic acid binding   by similarity   151   310
region of interest   Esterase domain-2   by similarity   311   365
region of interest   Fusion domain-2   by similarity   366   651
glycosylation site   N-linked (GlcNAc...)   potential   26   26
glycosylation site   N-linked (GlcNAc...)   potential   61   61
glycosylation site   N-linked (GlcNAc...)   potential   144   144
glycosylation site   N-linked (GlcNAc...)   potential   395   395
active site   Nucleophile   by similarity   71   71
active site   Charge relay system   by similarity   366   366
active site   Charge relay system   by similarity   369   369
SP Length   14
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MFFSLLLMLGLTEA
Sequence MFFSLLLMLGLTEAEKIKICLQKQVNSSFSLHNGFGGNLYATEEKRMFEL
VKPKAGASVL
NQSTWIGFGDSRTDKSNSAFPRSADVSAKTADKFRSLSGG
SLMLSMFGPPGKVDYLYQGCGKHKVFYEGVNWSPHAAINCYRK
NWTDIKL
NFQKNIYELASQSHCMSLVNALDKTIPLQATAGVAKNCNNSFLKNPALYT
QEVNPSVEKCGKENLAFFTLPTQFGTYECKLHLVASCYFIYDSKEVYNKR
GCDNYFQVIYDSSGKVVGGLDNRVSPYTGNSGDTPTMQCDMLQLKPGRYS
VRSSPRFLLM
PERSYCFDMKEKGPVTAVQSIWGKGRESDHAVDQACLSTP
GCMLIQKQKPYIGEA
DDHHGDQEMRELLSGLDYEARCISQSGWVNETSPF
TEEYLLPPKFGRCPLAAKEESIPKIPDGLLIPTSGTDTTVTKPKSRIFGI
DDLIIGLLFVAIVEAGIGGYLLGSRKVSGGGVTKESAEKGFEKIGNDIQI
LRSSTNIAIEKLNDRISHDEQAIRDLTLEIENARSEALLGELGIIRALLV
GNISIGLQESLWELASEITNRAGDLAVEVSPGCWVIDNNICDQSCQNFIF
KFNETAPVPTIPPLDTKIDLQSDPFYWGSSLGLAITAAISLAALVISGIA
I
CRTK
Original MFFSLLLMLGLTEAEKIKICLQKQVNSSFSLHNGFGGNLYATEEKRMFEL
VKPKAGASVLNQSTWIGFGDSRTDKSNSAFPRSADVSAKTADKFRSLSGG
SLMLSMFGPPGKVDYLYQGCGKHKVFYEGVNWSPHAAINCYRKNWTDIKL
NFQKNIYELASQSHCMSLVNALDKTIPLQATAGVAKNCNNSFLKNPALYT
QEVNPSVEKCGKENLAFFTLPTQFGTYECKLHLVASCYFIYDSKEVYNKR
GCDNYFQVIYDSSGKVVGGLDNRVSPYTGNSGDTPTMQCDMLQLKPGRYS
VRSSPRFLLMPERSYCFDMKEKGPVTAVQSIWGKGRESDHAVDQACLSTP
GCMLIQKQKPYIGEADDHHGDQEMRELLSGLDYEARCISQSGWVNETSPF
TEEYLLPPKFGRCPLAAKEESIPKIPDGLLIPTSGTDTTVTKPKSRIFGI
DDLIIGLLFVAIVEAGIGGYLLGSRKVSGGGVTKESAEKGFEKIGNDIQI
LRSSTNIAIEKLNDRISHDEQAIRDLTLEIENARSEALLGELGIIRALLV
GNISIGLQESLWELASEITNRAGDLAVEVSPGCWVIDNNICDQSCQNFIF
KFNETAPVPTIPPLDTKIDLQSDPFYWGSSLGLAITAAISLAALVISGIA
ICRTK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11