Signal Peptide Database - Viruses

 Entry Details
ID   611
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q0Q470    (Created: 2007-05-29 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   NS7A_BC279
Protein Name   Protein 7a
Gene   7a
Organism Scientific   Bat coronavirus 279/2005
Organism Common   BtCoV
Lineage   Viruses
  ssRNA positive-strand viruses, no DNA stage
    Nidovirales
      Coronaviridae
        Coronavirus
          Coronavirus group 2
            Coronavirus group 2b
              unclassified Coronavirus group 2b
Protein Length [aa]   122
Protein Mass [Da]   13842
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   15
chain   Protein 7a      16   122
transmembrane region      potential   97   117
topological domain   Extracellular   potential   16   96
topological domain   Cytoplasmic   potential   118   122
short sequence motif   Di-lysine motif   by similarity   118   122
SP Length   15
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKIILFLTLIALASS
Sequence MKIILFLTLIALASSELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLA
DNKFALTCISTHFAFACADGTRHTYQLRARSVSPKLFTRQEEVHQE
LYSP
LFLIVAALVFIILCFTI
KRKTE
Original MKIILFLTLIALASSELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLA
DNKFALTCISTHFAFACADGTRHTYQLRARSVSPKLFTRQEEVHQELYSP
LFLIVAALVFIILCFTIKRKTE
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11