Signal Peptide Database - Viruses

 Entry Details
ID   754
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q37935    (Created: 2001-04-27 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   RZ1_LAMBD
Protein Name   Outer membrane lipoprotein Rz1
Gene   Rz1
Organism Scientific   Enterobacteria phage lambda
Organism Common   Bacteriophage lambda
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Caudovirales
      Siphoviridae
        Lambda-like viruses
Protein Length [aa]   60
Protein Mass [Da]   6588
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   19
chain   Outer membrane lipoprotein Rz1      20   60
lipid moiety-binding region   N-palmitoyl cysteine; by host      20   20
lipid moiety-binding region   S-diacylglycerol cysteine; by host      20   20
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLKLKMMLCVMMLPLVVVG
Sequence MLKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPL
NGIISPSERG
Original MLKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPL
NGIISPSERG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11