Signal Peptide Database - Viruses

 Entry Details
ID   895
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P18569    (Created: 1990-11-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   UDPE_NPVAC
Protein Name   Ecdysteroid UDP-glucosyltransferase
Gene   EGT
Organism Scientific   Autographa californica nuclear polyhedrosis virus
Organism Common   AcMNPV
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Baculoviridae
      Alphabaculovirus
Protein Length [aa]   506
Protein Mass [Da]   57033
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   18
chain   Ecdysteroid UDP-glucosyltransferase      19   506
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MTILCWLALLSTLTAVNA
Sequence MTILCWLALLSTLTAVNAANILAVFPTPAYSHHIVYKVYIEALAEKCHNV
TVVKPKLFAYSTKTYCGNITEINADMSVEQYKKLVANSAMFRKRGVVSDT
DTVTAANYLGLIEMFKDQFDNINVRNLIANNQTFDLVVVEAFADYALVFG
HLYDPAPVIQIAPGYGLAENFDTVGAVARHPVHHPNIWRSNFDDTEANVM
TEMRLYKEFKILANMSNALLKQQFGPNTPTIEKLRNKVQLLLLNLHPIFD
NNRPVPPSVQYLGGGIHLVKSAPLTKLSPVINAQMNKSKSGTIYVSFGSS
IDTKSFANEFLYMLINTFKTLDNYTILWKIDDEVVKNITLPANVITQNWF
NQRAVLRHKKMAAFITQGGLQSSDEALEAGIPMVCLPMMGDQFYHAHKLQ
QLGVARALDTVTVSSDQLLVAINDVLFNAPTYKKHMAELYALINHDKATF
PPLDKAIKFTERVIRYRHDISRQLYSLKTTAANVPYSNYYMYKSVFSIVM
NHLTHF
Original MTILCWLALLSTLTAVNAANILAVFPTPAYSHHIVYKVYIEALAEKCHNV
TVVKPKLFAYSTKTYCGNITEINADMSVEQYKKLVANSAMFRKRGVVSDT
DTVTAANYLGLIEMFKDQFDNINVRNLIANNQTFDLVVVEAFADYALVFG
HLYDPAPVIQIAPGYGLAENFDTVGAVARHPVHHPNIWRSNFDDTEANVM
TEMRLYKEFKILANMSNALLKQQFGPNTPTIEKLRNKVQLLLLNLHPIFD
NNRPVPPSVQYLGGGIHLVKSAPLTKLSPVINAQMNKSKSGTIYVSFGSS
IDTKSFANEFLYMLINTFKTLDNYTILWKIDDEVVKNITLPANVITQNWF
NQRAVLRHKKMAAFITQGGLQSSDEALEAGIPMVCLPMMGDQFYHAHKLQ
QLGVARALDTVTVSSDQLLVAINDVLFNAPTYKKHMAELYALINHDKATF
PPLDKAIKFTERVIRYRHDISRQLYSLKTTAANVPYSNYYMYKSVFSIVM
NHLTHF
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11