Signal Peptide Database - Viruses

 Entry Details
ID   917
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P28967    (Created: 1992-12-01 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   VGLG_EHV1B
Protein Name   Glycoprotein G
Gene   70
Organism Scientific   Equine herpesvirus 1 (strain Ab4p)
Organism Common   EHV-1
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Herpesvirales
      Herpesviridae
        Alphaherpesvirinae
          Varicellovirus
Protein Length [aa]   411
Protein Mass [Da]   45270
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Glycoprotein G      20   411
transmembrane region      potential   363   379
glycosylation site   N-linked (GlcNAc...)   potential   83   83
glycosylation site   N-linked (GlcNAc...)   potential   138   138
glycosylation site   N-linked (GlcNAc...)   potential   222   222
glycosylation site   N-linked (GlcNAc...)   potential   245   245
glycosylation site   N-linked (GlcNAc...)   potential   317   317
glycosylation site   N-linked (GlcNAc...)   potential   392   392
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLTVLAALSLLSLLTSATG
Sequence MLTVLAALSLLSLLTSATGRLAPDELCYAEPRRTGSPPNTQPERPPVIFE
PPTIAIKAESKGCELILLDPPIDVSYRREDKV
NASIAWFFDFGACRMPIA
YREYYGCIGNAVPSPETCDAYSFTLIRTEGIVEFTIV
NMSLLFQPGIYDS
GNFIYSVLLDYHIFTGRVTLEVEKDTNYPCGMIHGLTAYGNINVDETMDN
ASPHPRAVGCFPEPIDNEAWA
NVTFTELGIPDPNSFLDDEGDYPNISDCH
SWESYTYPNTLRQATGPQTLLVGAVGLRILAQAWKFVGDETYDTIRAEAK
NLETHVPSSAAESSLE
NQSTQEESNSPEVAHLRSVNSDDSTHTGGASNGI
QDCDSQLKTVYA
CLALIGLGTCAMIGLIVYICVLRSKLSSRNFSRAQNVK
HRNYQRLEYVA
Original MLTVLAALSLLSLLTSATGRLAPDELCYAEPRRTGSPPNTQPERPPVIFE
PPTIAIKAESKGCELILLDPPIDVSYRREDKVNASIAWFFDFGACRMPIA
YREYYGCIGNAVPSPETCDAYSFTLIRTEGIVEFTIVNMSLLFQPGIYDS
GNFIYSVLLDYHIFTGRVTLEVEKDTNYPCGMIHGLTAYGNINVDETMDN
ASPHPRAVGCFPEPIDNEAWANVTFTELGIPDPNSFLDDEGDYPNISDCH
SWESYTYPNTLRQATGPQTLLVGAVGLRILAQAWKFVGDETYDTIRAEAK
NLETHVPSSAAESSLENQSTQEESNSPEVAHLRSVNSDDSTHTGGASNGI
QDCDSQLKTVYACLALIGLGTCAMIGLIVYICVLRSKLSSRNFSRAQNVK
HRNYQRLEYVA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11