Signal Peptide Database - Viruses

 Entry Details
ID   918
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q66T62    (Created: 2007-07-24 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   VGLG_RABVB
Protein Name   Glycoprotein G
Gene   G
Organism Scientific   Rabies virus (strain silver-haired bat-associated)
Organism Common   RABV
Lineage   Viruses
  ssRNA negative-strand viruses
    Mononegavirales
      Rhabdoviridae
        Lyssavirus
Protein Length [aa]   524
Protein Mass [Da]   58203
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Glycoprotein G      20   524
transmembrane region      potential   460   480
topological domain   Extracellular   potential   20   459
topological domain   Cytoplasmic   potential   481   524
glycosylation site   N-linked (GlcNAc...)   potential   256   256
glycosylation site   N-linked (GlcNAc...)   by similarity   338   338
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   480   480
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MIPQALLFVPLLIPSLCLG
Sequence MIPQALLFVPLLIPSLCLGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVE
DEGCTSLSGFSYMELKVGYISAMKVNGFTCTGVVTEAETYTNFVGYVTTT
FKRKHFRPMPDACRAAHDWKIAGDPRYEDSLQNPYPDYHWLRTVKTTKES
LVIISPSVADLDPYDKSLHSRVFPSGKCLGITVSSTYCPTNHDYTIWMPV
EARLGTSCDIFTNSRGKKASKGGRTCGFVDERGLYKSLKGACKLKLCGVP
GLRLM
NGTWVSIQTSDDIKWCPPDQLVNLHDFHSDEIEHLVVEELIKKRE
GCLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIF
NNTLMEADAHYKS
VRTWNEVIPSKGCLKVGGRCHPPVNGVFFNGIILGPDGNVLIPEMQSSLL
QQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQVSDVD
LGLPSWGKY
LLMSAGALATLILAIFLITCCRRANRTKSTQRGHRESGGKV
SVAPQNGKIISSWELYKSESETGM
Original MIPQALLFVPLLIPSLCLGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVE
DEGCTSLSGFSYMELKVGYISAMKVNGFTCTGVVTEAETYTNFVGYVTTT
FKRKHFRPMPDACRAAHDWKIAGDPRYEDSLQNPYPDYHWLRTVKTTKES
LVIISPSVADLDPYDKSLHSRVFPSGKCLGITVSSTYCPTNHDYTIWMPV
EARLGTSCDIFTNSRGKKASKGGRTCGFVDERGLYKSLKGACKLKLCGVP
GLRLMNGTWVSIQTSDDIKWCPPDQLVNLHDFHSDEIEHLVVEELIKKRE
GCLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNNTLMEADAHYKS
VRTWNEVIPSKGCLKVGGRCHPPVNGVFFNGIILGPDGNVLIPEMQSSLL
QQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQVSDVD
LGLPSWGKYLLMSAGALATLILAIFLITCCRRANRTKSTQRGHRESGGKV
SVAPQNGKIISSWELYKSESETGM
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11