Signal Peptide Database - Viruses

 Entry Details
ID   919
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P08668    (Created: 1988-01-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   VGLM_HANTV
Protein Name   Envelope glycoprotein
Gene   M
Organism Scientific   Hantaan virus (strain 76-118)
Organism Common   Korean hemorrhagic fever virus
Lineage   Viruses
  ssRNA negative-strand viruses
    Bunyaviridae
      Hantavirus
Protein Length [aa]   1135
Protein Mass [Da]   126421
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   18
chain   Envelope glycoprotein      19   1135
chain   Glycoprotein G1      19   648
chain   Glycoprotein G2      649   1126
transmembrane region      potential   486   506
transmembrane region      potential   1106   1126
topological domain   Lumenal   potential   1   485
topological domain   Cytoplasmic   potential   507   648
topological domain   Lumenal   potential   649   1105
topological domain   Cytoplasmic   potential   1127   1135
domain   ITAM      611   634
glycosylation site   N-linked (GlcNAc...)   potential   134   134
glycosylation site   N-linked (GlcNAc...)   potential   235   235
glycosylation site   N-linked (GlcNAc...)   potential   347   347
glycosylation site   N-linked (GlcNAc...)   potential   399   399
glycosylation site   N-linked (GlcNAc...)   potential   928   928
site   Cleavage; by host signal peptidase      645   646
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGIWKWLVMASLVWPVLT
Sequence MGIWKWLVMASLVWPVLTLRNVYDMKIECPHTVSFGENSVIGYVELPPVP
LADTAQMVPESSCNMDNHQSLNTITKYTQVSWRGKADQSQSSQNSFETVS
TEVDLKGTCVLKHKMVEESYRSRKSVTCYDLSC
NSTYCKPTLYMIVPIHA
CNMMKSCLIALGPYRVQVVYERSYCMTGVLIEGKCFVPDQSVVSIIKHGI
FDIASVHIVCFFVAVKGNTYKIFEQVKKSFESTC
NDTENKVQGYYICIVG
GNSAPIYVPTLDDFRSMEAFTGIFRSPHGEDHDLAGEEIASYSIVGPANA
KVPHSASSDTLSLIAYSGIPSYSSLSILTSSTEAKHVFSPGLFPKL
NHTN
CDKSAIPLIWTGMIDLPGYYEAVHPCTVFCVLSGPGASCEAFSEGGIF
NI
TSPMCLVSKQNRFRLTEQQVNFVCQRVDMDIVVYCNGQRKVILTKTLVIG
QCIYTITSLFSLLPGVAHSIAVELCVPGFHGWATA
ALLVTFCFGWVLIPA
ITFIIL
TVLKFIANIFHTSNQENRLKSVLRKIKEEFEKTKGSMVCDVCKY
ECETYKELKAHGVSCPQSQCPYCFTHCEPTEAAFQAHYKVCQVTHRFRDD
LKKTVTPQNF
TPGCYRTLNLFRYKSRCYIFTMWIFLLVLESILWAASASE
TPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQS
IDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAK
CHYERDYQYETSWGCNPSDCPGVGTGCTACGLYLDQLKPVGSAYKIITIR
YSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFSQGDTLLFFG
PLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNFAT
TPICEYDGNMVSGYKKVMATIDSFQSF
NTSTMHFTDERIEWKDPDGMLRD
HINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTEC
PTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGED
CSQIGLHAAAPHLDKVNGISEIENSKVYDDGAPQCGIKCWFVKSGEWISG
IFSGN
WIVLIVLCVFLLFSLVLLSILCPVRKHKKS
Original MGIWKWLVMASLVWPVLTLRNVYDMKIECPHTVSFGENSVIGYVELPPVP
LADTAQMVPESSCNMDNHQSLNTITKYTQVSWRGKADQSQSSQNSFETVS
TEVDLKGTCVLKHKMVEESYRSRKSVTCYDLSCNSTYCKPTLYMIVPIHA
CNMMKSCLIALGPYRVQVVYERSYCMTGVLIEGKCFVPDQSVVSIIKHGI
FDIASVHIVCFFVAVKGNTYKIFEQVKKSFESTCNDTENKVQGYYICIVG
GNSAPIYVPTLDDFRSMEAFTGIFRSPHGEDHDLAGEEIASYSIVGPANA
KVPHSASSDTLSLIAYSGIPSYSSLSILTSSTEAKHVFSPGLFPKLNHTN
CDKSAIPLIWTGMIDLPGYYEAVHPCTVFCVLSGPGASCEAFSEGGIFNI
TSPMCLVSKQNRFRLTEQQVNFVCQRVDMDIVVYCNGQRKVILTKTLVIG
QCIYTITSLFSLLPGVAHSIAVELCVPGFHGWATAALLVTFCFGWVLIPA
ITFIILTVLKFIANIFHTSNQENRLKSVLRKIKEEFEKTKGSMVCDVCKY
ECETYKELKAHGVSCPQSQCPYCFTHCEPTEAAFQAHYKVCQVTHRFRDD
LKKTVTPQNFTPGCYRTLNLFRYKSRCYIFTMWIFLLVLESILWAASASE
TPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQS
IDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAK
CHYERDYQYETSWGCNPSDCPGVGTGCTACGLYLDQLKPVGSAYKIITIR
YSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFSQGDTLLFFG
PLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNFAT
TPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLRD
HINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTEC
PTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGED
CSQIGLHAAAPHLDKVNGISEIENSKVYDDGAPQCGIKCWFVKSGEWISG
IFSGNWIVLIVLCVFLLFSLVLLSILCPVRKHKKS
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11